1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. BSSP-4 Protein, Human (HEK293, His)

BSSP-4 Protein, Human (HEK293, His)

Cat. No.: HY-P70108
Handling Instructions

BSSP-4 Protein is notable for its specific preference in cleaving the synthetic substrate H-D-Leu-Thr-Arg-pNA over tosyl-Gly-Pro-Arg-pNA. This enzymatic selectivity indicates BSSP-4's potential modulation of specific peptide sequences, emphasizing its relevance in biological processes. BSSP-4 Protein, Human (HEK293, His) is the recombinant human-derived BSSP-4 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of BSSP-4 Protein, Human (HEK293, His) is 285 a.a., with molecular weight of 33-35 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

BSSP-4 Protein is notable for its specific preference in cleaving the synthetic substrate H-D-Leu-Thr-Arg-pNA over tosyl-Gly-Pro-Arg-pNA. This enzymatic selectivity indicates BSSP-4's potential modulation of specific peptide sequences, emphasizing its relevance in biological processes. BSSP-4 Protein, Human (HEK293, His) is the recombinant human-derived BSSP-4 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of BSSP-4 Protein, Human (HEK293, His) is 285 a.a., with molecular weight of 33-35 kDa.

Background

The BSSP-4 protein takes center stage as it exhibits a distinct preference for cleaving the synthetic substrate H-D-Leu-Thr-Arg-pNA in comparison to tosyl-Gly-Pro-Arg-pNA. This enzymatic specificity highlights BSSP-4's selectivity in substrate recognition and cleavage, showcasing its potential role in modulating specific peptide sequences. The preference for H-D-Leu-Thr-Arg-pNA over tosyl-Gly-Pro-Arg-pNA suggests a substrate specificity that could be relevant to the protein's functional role in biological processes.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q9GZN4 (A33-S317)

Gene ID
Molecular Construction
N-term
BSSP-4 (A33-S317)
Accession # Q9GZN4
6*His
C-term
Synonyms
rHuBrain-specific serine protease 4/BSSP-4, His; Brain-Specific Serine Protease 4; BSSP-4; Serine Protease 22; Serine Protease 26; Tryptase Epsilon; PRSS22; BSSP4; PRSS26
AA Sequence

ARIPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTSRWVITAAHCFKDNLNKPYLFSVLLGAWQLGNPGSRSQKVGVAWVEPHPVYSWKEGACADIALVRLERSIQFSERVLPICLPDASIHLPPNTHCWISGWGSIQDGVPLPHPQTLQKLKVPIIDSEVCSHLYWRGAGQGPITEDMLCAGYLEGERDACLGDSGGPLMCQVDGAWLLAGIISWGEGCAERNRPGVYISLSAHRSWVEKIVQGVQLRGRAQGGGALRAPSQGSGAAARS

Molecular Weight

33-35 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

BSSP-4 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BSSP-4 Protein, Human (HEK293, His)
Cat. No.:
HY-P70108
Quantity:
MCE Japan Authorized Agent: