BTLA/CD272 Protein, Human (HEK293, His)

The BTLA/CD272 protein is expressed on lymphocytes and is a negative regulator of antigen receptor signaling. It interacts with the tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2 to regulate immune responses and maintain lymphocyte homeostasis. BTLA/CD272 Protein, Human (HEK293, His) is the recombinant human-derived BTLA/CD272 protein, expressed by HEK293 , with C-6*His labeled tag.

BTLA/CD272, an inhibitory receptor expressed on lymphocytes, serves as a negative regulator of antigen receptor signaling through interactions with tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2. These interactions contribute to the modulation of immune responses and the maintenance of lymphocyte homeostasis. BTLA may engage in both cis and trans interactions with TNFRSF14, with cis interactions playing a regulatory role in naive T cells, inhibiting trans interactions to maintain a resting state. In contrast, trans interactions, predominant during adaptive immune responses, provide survival signals to effector T cells. The intricate interplay between BTLA and its binding partners underscores its multifaceted role in immune regulation.

Human

HEK293

C-6*His

Q7Z6A9-2 (K31-L150)

151888  [NCBI]

KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTGKQNELSDTAGREINLHHHHHH

Approximately 30.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.