1. Recombinant Proteins
  2. Immune Checkpoint Proteins Biotinylated Proteins
  3. Butyrophilins
  4. BTN3A2
  5. BTN3A2 Protein, Human (Biotinylated, HEK293, His-Avi)

BTN3A2 Protein, Human (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P72346
Handling Instructions Technical Support

BTN3A2 protein, functioning as a homodimer, regulates T-cell responses in the adaptive immune system by inhibiting the release of IFNG from activated T-cells. BTN3A2 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived BTN3A2 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

BTN3A2 protein, functioning as a homodimer, regulates T-cell responses in the adaptive immune system by inhibiting the release of IFNG from activated T-cells. BTN3A2 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived BTN3A2 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Background

BTN3A2 protein assumes a pivotal role in the adaptive immune response, specifically influencing T-cell responses. It exhibits the capability to modulate immune reactions by inhibiting the release of IFNG from activated T-cells. Furthermore, BTN3A2 forms homodimers, underscoring its functional relevance and potential impact on cellular processes in the immune system.

Species

Human

Source

HEK293

Tag

C-Avi;C-6*His

Accession

P78410-1 (Q30-W248)

Gene ID
Molecular Construction
N-term
BTN3A2 (Q30-W248)
Accession # P78410-1
6*His-Avi
C-term
Synonyms
Butyrophilin subfamily 3 member A2; BT3.2; BTF3; BTF4
AA Sequence

QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPW

Molecular Weight

30-35 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

BTN3A2 Protein, Human (Biotinylated, HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BTN3A2 Protein, Human (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P72346
Quantity:
MCE Japan Authorized Agent: