1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. Stem Cell CD Proteins Platelet CD Proteins
  4. TPO-R/CD110
  5. C-MPL Protein, Rat (HEK293, Fc)

The C-MPL Protein, a receptor for thrombopoietin, is a protein encoded in humans by the oncogene of myeloproliferative leukemia virus. The C-MPL Protein is involved in the activation of the JAK/STAT/MAPK signaling pathway. C-MPL Protein is a biomarker for thrombocytopenia. C-MPL Protein, Rat (HEK293, Fc) is the recombinant rat-derived C-MPL protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The C-MPL Protein, a receptor for thrombopoietin, is a protein encoded in humans by the oncogene of myeloproliferative leukemia virus. The C-MPL Protein is involved in the activation of the JAK/STAT/MAPK signaling pathway. C-MPL Protein is a biomarker for thrombocytopenia. C-MPL Protein, Rat (HEK293, Fc) is the recombinant rat-derived C-MPL protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The thrombopoietin receptor, also known as myeloproliferative leukemia protein or CD110 (differentiated cluster 110), is a protein encoded in humans by the myeloproliferative leukemia virus oncogene. C-MPL can activate thrombopoietin receptors, participate in bone marrow cell homeostasis, and platelet aggregation and actively regulate the process of platelet formation. C-MPL is involved in the phosphorylation of JAK/STAT/MAPK family proteins. C-MPL is a biomarker for thrombocytopenia[1][2][3].

Species

Rat

Source

HEK293

Tag

C-hFc

Accession

A0A1W2Q6N1/XP_001072502.1 (Q22-A500)

Gene ID
Molecular Construction
N-term
C-MPL (Q22-A500)
Accession # A0A1W2Q6N1/XP_001072502.1
hFc
C-term
Synonyms
CD110; c-Mpl; MPL; MPLV; Thrombopoietin R; TPO-R
AA Sequence

QVTSQDVFLLALGTEPLNCFSQTFEDLTCFWDEEEAAPSWIYQLLYAYPGEKPRPCPLHSQSVPTFGTRYVCQFPALDEVRLFFPLHLWVKNVFLNQTLMQRVLFVDTVGLPAPPSVIKARGGSQPGELQIHWEAPAPEISNFLRHELRYGPTDSSNATAPSVIQLLSTETCCPTLRMPNPVRVLDQHPCVHPTASQQHGPMRTSPAGEAPSLAVKGGSCLISGLHAGQSYWLQLRSQPDGVSLRGSWGPWSLPVTVDLPGDAVAIGLQCFTVDLKKVICQWQQQDHSSSRGFFRHSRTRCCPTDRDPTWEKCEEEEEEEEEEKEEGELDPGSRPALFSRCHFKSRNDSVIHILVEVTTAQGAIHSYLGSPFWIRQAVLLPTPSLHWREISSGRLELEWQHPSPWAAQETCYQLRYTGEGHEDWKVLEPSLGAQGGTLELRPRARYSLQLRARLNGPTYQGPWSAWSPPARVSTGSETA

Molecular Weight

Approximately 80.7 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
C-MPL Protein, Rat (HEK293, Fc)
Cat. No.:
HY-P74244
Quantity:
MCE Japan Authorized Agent: