C1QTNF3/CTRP3 Protein, Human (His)

C1QTNF3/CTRP3 Protein is a secreted protein of the C1q/ TNF-associated protein (CTRPs) family. C1QTNF3/CTRP3 Protein by participating in the TGF-尾1/Smad, Sirtuin 1/NF-魏B, AMPK and Signaling pathways such as LAMP1/JIP2/JNK have extensive effects on tumor, inflammation, metabolism, and insulin sensitization. C1QTNF3/CTRP3 Protein, Human (His) is the recombinant human-derived C1QTNF3/CTRP3 protein, expressed by E. coli , with N-His labeled tag.

C1q/ TNF-associated proteins (CTRPs) are a family of secreted proteins with a specific structure. CTRPs have a wide range of effects on survival signaling, inflammation, metabolism and insulin sensitization. Complement C1q tumor necrosis factor-related protein 3 inhibits proliferation, migration, and ECM accumulation in keloid fibroblasts by regulating TGF-β1/Smad signaling pathway. Play an anti-fibrotic role. C1QTNF3 is involved in the pathogenesis and insulin resistance of polycystic ovary syndrome (PCOS). C1qtnf3 reduces intestinal inflammation through the Sirtuin 1/NF-κB signaling pathway. C1QTNF3 affects lipid metabolism and necrotic inflammation of renal tubular cells through AMPK signaling pathway. C1QTNF3 alleviates myocardial ischemia/reperfusion injury in mice by activating the LAMP1/JIP2/JNK pathway^{[1][2][3][4][5]}.

Human

E. coli

N-His

Q9BXJ4-1 (Q23-K246)

114899  [NCBI]

QDEYMESPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK

Approximately 28.2 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in PBS, 6% Trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.