1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. Calcitonin
  5. Calcitonin/CALCA Protein, Human (His)

Calcitonin Protein, Human (His), is a recombinant human Calcitonin expressed in E. coli with a His tag at the N-terminus. Calcitonin has an effect on decreasing osteoclast activity and has the potential for hypercalcemia research.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Calcitonin Protein, Human (His), is a recombinant human Calcitonin expressed in E. coli with a His tag at the N-terminus. Calcitonin has an effect on decreasing osteoclast activity and has the potential for hypercalcemia research[1].

Background

Calcitonin is a 32 amino acid hormone secreted by the C-cells of the thyroid gland. Calcitonin secretion is stimulated by increases in the serum calcium concentration and calcitonin protects against the development of hypercalcemia. Calcitonin is also stimulated by gastrointestinal hormones such as gastrin[1].

Biological Activity

Measured by its ability to induce alkaline phosphatase production by MC3T3-E1 mouse chondrogenic cells. The ED50 for this effect is 0.8463 µg/mL, corresponding to a specific activity is 1181.614 units/mg.

  • Measured by its ability to induce alkaline phosphatase production by MC3T3-E1 mouse chondrogenic cells. The ED50 for this effect is 0.8463 µg/mL, corresponding to a specific activity is 1181.614 units/mg.
Species

Human

Source

E. coli

Tag

C-6*His

Accession

P01258-1 (Y58-N141)

Gene ID

796

Molecular Construction
N-term
CALCA (Y58-N141)
Accession # P01258
6*His
C-term
Synonyms
rHuCalcitonin, His; Calcitonin; Katacalcin; Calcitonin Carboxyl-Terminal Peptide; CCP; PDN-21; CALCA; CALC1
AA Sequence

YVQMKASELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQNAN

Molecular Weight

Approximately 15.0 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 6.2, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Calcitonin/CALCA Protein, Human (His) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Calcitonin/CALCA Protein, Human (His)
Cat. No.:
HY-P7708A
Quantity:
MCE Japan Authorized Agent: