Calcitonin/CALCA Protein, Human (His)

Calcitonin Protein, Human (His), is a recombinant human Calcitonin expressed in E. coli with a His tag at the N-terminus. Calcitonin has an effect on decreasing osteoclast activity and has the potential for hypercalcemia research^[1].

Calcitonin is a 32 amino acid hormone secreted by the C-cells of the thyroid gland. Calcitonin secretion is stimulated by increases in the serum calcium concentration and calcitonin protects against the development of hypercalcemia. Calcitonin is also stimulated by gastrointestinal hormones such as gastrin^[1].

Measured by its ability to induce alkaline phosphatase production by MC3T3-E1 mouse chondrogenic cells. The ED₅₀ for this effect is 0.8463 µg/mL, corresponding to a specific activity is 1181.614 units/mg.

Human

E. coli

C-6*His

P01258-1 (Y58-N141)

796

YVQMKASELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQNAN

Approximately 15.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 6.2, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.