Calcitonin/CALCA Protein, Human (His)

Calcitonin Protein, Human (His), is a recombinant human Calcitonin expressed in E. coli with a His tag at the N-terminus. Calcitonin has an effect on decreasing osteoclast activity and has the potential for hypercalcemia research^[1].

Calcitonin is a 32 amino acid hormone secreted by the C-cells of the thyroid gland. Calcitonin secretion is stimulated by increases in the serum calcium concentration and calcitonin protects against the development of hypercalcemia. Calcitonin is also stimulated by gastrointestinal hormones such as gastrin^[1].

Human

E. coli

C-6*His

P01258 (Y58-N141)

796  [NCBI]

YVQMKASELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQNANHHHHHH

Approximately 16.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filter solution of 20 mM PB, 150 mM NaCl, 50% Glycerol, pH7.4.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. Arnold J Felsenfeld, et al. Calcitonin, the forgotten hormone: does it deserve to be forgotten? Clin Kidney J. 2015 Apr;8(2):180-7.  [Content Brief]