1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. Calcitonin
  5. Calcitonin/CALCA Protein, Human (His, solution)

Calcitonin/CALCA Protein, Human (His, solution)

Cat. No.: HY-P7708
SDS COA Handling Instructions Technical Support

Calcitonin Protein, Human (His, solution), is a recombinant human Calcitonin expressed in E. coli with a His tag at the N-terminus. Calcitonin has an effect on decreasing osteoclast activity and has the potential for hypercalcemia research.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Calcitonin/CALCA Protein, Human (His, solution) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Calcitonin Protein, Human (His, solution), is a recombinant human Calcitonin expressed in E. coli with a His tag at the N-terminus. Calcitonin has an effect on decreasing osteoclast activity and has the potential for hypercalcemia research[1].

Background

Calcitonin is a 32 amino acid hormone secreted by the C-cells of the thyroid gland. Calcitonin secretion is stimulated by increases in the serum calcium concentration and calcitonin protects against the development of hypercalcemia. Calcitonin is also stimulated by gastrointestinal hormones such as gastrin[1].

Species

Human

Source

E. coli

Tag

C-6*His

Accession

P01258 (Y58-N141)

Gene ID

796  [NCBI]

Molecular Construction
N-term
CALCA (Y58-N141)
Accession # P01258
6*His
C-term
Synonyms
rHuCalcitonin, His; Calcitonin; Katacalcin; Calcitonin Carboxyl-Terminal Peptide; CCP; PDN-21; CALCA; CALC1
AA Sequence

YVQMKASELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQNANHHHHHH

Molecular Weight

Approximately 16.0 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filter solution of 20 mM PB, 150 mM NaCl, 50% Glycerol, pH7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
References

Calcitonin/CALCA Protein, Human (His, solution) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Calcitonin/CALCA Protein, Human (His, solution)
Cat. No.:
HY-P7708
Quantity:
MCE Japan Authorized Agent: