CALML5 Protein, Human (His)

The CALML5 protein is known for its calcium-binding ability and may be involved in terminal differentiation of keratinocytes, suggesting a role in skin cell maturation. Its association with transglutaminase 3 suggests cooperation in skin development function. CALML5 Protein, Human (His-GST) is the recombinant human-derived CALML5 protein, expressed by E. coli , with N-His, N-GST labeled tag. The total length of CALML5 Protein, Human (His-GST) is 146 a.a., with molecular weight of ~43 kDa.

The CALML5 Protein is characterized by its calcium-binding capacity and may play a role in the terminal differentiation of keratinocytes. This suggests a potential involvement in key processes associated with the maturation and specialization of these skin cells. Notably, CALML5 associates with transglutaminase 3, indicating a possible collaborative role in cellular functions related to skin development and maintenance. The calcium-binding property of CALML5 likely contributes to its regulatory functions in these processes, underscoring its significance in the intricate molecular mechanisms governing keratinocyte differentiation.

Human

E. coli

N-His

Q9NZT1 (M1-E146)

51806  [NCBI]

MAGELTPEEEAQYKKAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDSDGDGEISFQEFLTAAKKARAGLEDLQVAFRAFDQDGDGHITVDELRRAMAGLGQPLPQEELDAMIREADVDQDGRVNYEEFARMLAQE

Approximately 15-18 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween80.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.