1. Recombinant Proteins
  2. Others
  3. Calreticulin/CALR Protein, Human (His)

Calreticulin/CALR Protein, Human (His)

Cat. No.: HY-P72111
SDS COA Handling Instructions

The calreticulin/CALR protein is a calcium-binding molecular chaperone that promotes ER folding and quality control. It interacts with monoglucosylated glycoproteins and promotes nuclear export of NR3C1. Calreticulin/CALR Protein, Human (His) is the recombinant human-derived Calreticulin/CALR protein, expressed by E. coli , with N-6*His labeled tag. The total length of Calreticulin/CALR Protein, Human (His) is 400 a.a., with molecular weight of ~50.6 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The calreticulin/CALR protein is a calcium-binding molecular chaperone that promotes ER folding and quality control. It interacts with monoglucosylated glycoproteins and promotes nuclear export of NR3C1. Calreticulin/CALR Protein, Human (His) is the recombinant human-derived Calreticulin/CALR protein, expressed by E. coli , with N-6*His labeled tag. The total length of Calreticulin/CALR Protein, Human (His) is 400 a.a., with molecular weight of ~50.6 kDa.

Background

Calreticulin/CALR protein is a calcium-binding chaperone that plays a crucial role in the endoplasmic reticulum (ER) by promoting folding, oligomeric assembly, and quality control. It achieves this through the calreticulin/calnexin cycle, where it interacts transiently with almost all monoglucosylated glycoproteins synthesized in the ER. Additionally, calreticulin/CALR protein interacts with the DNA-binding domain of NR3C1, facilitating its nuclear export. It is also involved in the regulation of maternal gene expression and may participate in oocyte maturation by regulating calcium homeostasis. During oocyte activation, calreticulin/CALR protein is exocytosed from cortical granules and potentially contributes to the blockage of polyspermy. It exists as a monomer and is part of an EIF2 complex composed of various proteins such as CELF1/CUGBP1, CALR, CALR3, EIF2S1, EIF2S2, HSP90B1, and HSPA5. Calreticulin/CALR protein interacts with several other proteins, including PDIA3/ERp57, SPACA9, TRIM21, NR3C1, PPIB, PDIA5, GABARAP, HLA-E-B2M, HLA-G-B2M complexes, HLA-F, and CLCC1.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P27797 (E18-L417)

Gene ID

811  [NCBI]

Molecular Construction
N-term
6*His
CALR (E18-L417)
Accession # P27797
C-term
Synonyms
Autoantigen RO; CALR; CALR protein; CALR_HUMAN; Calregulin; Calreticulin; cC1qR; CRP55; CRT; CRTC; Endoplasmic reticulum resident protein 60; Epididymis secretory sperm binding protein Li 99n; ERp60; FLJ26680; grp60; HACBP; HEL S 99n; RO; Sicca syndrome antigen A autoantigen Ro; calreticulin; ; Sicca syndrome antigen A; SSA
AA Sequence

EPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL

Molecular Weight

Approximately 50.6 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HC1, 0.5 M NaCl, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Calreticulin/CALR Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Calreticulin/CALR Protein, Human (His)
Cat. No.:
HY-P72111
Quantity:
MCE Japan Authorized Agent: