1. Recombinant Proteins
  2. Others
  3. Canf1 Protein, Canine (HEK293, His)

Canf1 Protein, Canine (HEK293, His)

Cat. No.: HY-P76764
COA Handling Instructions

Canf1 Protein is a major dog allergen. It is a protein produced in the canine VonEbner's glands and the possible role of the protein is in taste reception. Canf1 is mainly derived from dog dander, pelt hair and saliva. Exposure and sensitization to dog allergen is a significant cause of asthma. Canf1 Protein, Canine (HEK293, His) is the recombinant canine-derived Canf1 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $35 In-stock
10 μg $50 In-stock
50 μg $130 In-stock
100 μg $220 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Canf1 Protein is a major dog allergen. It is a protein produced in the canine VonEbner's glands and the possible role of the protein is in taste reception. Canf1 is mainly derived from dog dander, pelt hair and saliva. Exposure and sensitization to dog allergen is a significant cause of asthma. Canf1 Protein, Canine (HEK293, His) is the recombinant canine-derived Canf1 protein, expressed by HEK293 , with C-His labeled tag.

Background

Canf1 is a major dog allergen. It is a protein produced in the canine VonEbner's glands and the possible role of the protein is in taste reception. Canf1 is mainly derived from dog dander, pelt hair and saliva. Exposure and sensitization to dog allergen is a significant cause of asthma[1].

Species

Canine

Source

HEK293

Tag

C-6*His

Accession

O18873/NP_001003190.1 (Q19-Q174)

Gene ID

403830  [NCBI]

Molecular Construction
N-term
Canf1 (Q19-Q174)
Accession # O18873/NP_001003190.1
His
C-term
Synonyms
Major allergen Can f 1; Allergen Dog 1; Can f 1
AA Sequence

QDTPALGKDTVAVSGKWYLKAMTADQEVPEKPDSVTPMILKAQKGGNLEAKITMLTNGQCQNITVVLHKTSEPGKYTAYEGQRVVFIQPSPVRDHYILYCEGELHGRQIRMAKLLGRDPEQSQEALEDFREFSRAKGLNQEILELAQSETCSPGGQ

Molecular Weight

Approximately 19-24 kDa due to the glycosylation

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Canf1 Protein, Canine (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Canf1 Protein, Canine (HEK293, His)
Cat. No.:
HY-P76764
Quantity:
MCE Japan Authorized Agent: