Carbonic Anhydrase 1 Protein, Human (C-His)

Carbonic Anhydrase 1 Protein, Human (C-His) is the recombinant human-derived Carbonic Anhydrase 1, expressed by E. coli , with C-6*His labeled tag. The total length of Carbonic Anhydrase 1 Protein, Human (C-His) is 260 a.a.,

Measured by its esterase activity. The specific activity is ≥24.83 pmol/min/μg, as measured under the described conditions.

Human

E. coli

C-6*His

P00915 (A2-F261)

759

ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF

Approximately 29 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 8.0, 20% glycerol or PBS, pH 7.4, 8% trehalose, 8% mannitol and 0.02% Tween80.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.