Carbonic Anhydrase 10 Protein, Human (HEK293)

Carbonic anhydrase 10 (CA10) protein, contrary to its name, lacks catalytic activity. This property distinguishes CA10 from typical carbonic anhydrases, which are known for their ability to catalyze the reversible hydration of carbon dioxide. Carbonic Anhydrase 10 Protein, Human (HEK293 ) is the recombinant human-derived Carbonic Anhydrase 10 protein, expressed by HEK293 , with tag free.

Carbonic Anhydrase 10 (CA10) protein, based on available information, does not exhibit catalytic activity. In contrast to typical carbonic anhydrases that participate in the reversible hydration of carbon dioxide, CA10 appears to lack this enzymatic function. The absence of catalytic activity suggests that CA10 may have a distinct role, possibly serving as a structural protein or participating in non-enzymatic cellular processes. Further research is required to uncover the specific molecular functions and physiological implications associated with CA10, shedding light on its unique contributions within cellular pathways. Understanding the functional characteristics of CA10, especially in the context of its non-catalytic nature, is essential for unraveling its role in biological processes and potential relevance to health and disease. (

Human

HEK293

Tag Free

Q9NS85-1 (Q22-N300)

56934  [NCBI]

MEIVWEVLFLLQANFIVCISAQQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNRDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTN

Approximately 38 kDa

Greater than 95% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.