1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Carbonic Anhydrase
  4. Carbonic Anhydrase 10
  5. Carbonic Anhydrase 10 Protein, Human (HEK293)

Carbonic Anhydrase 10 Protein, Human (HEK293)

Cat. No.: HY-P72864
Handling Instructions Technical Support

Carbonic anhydrase 10 (CA10) protein, contrary to its name, lacks catalytic activity. This property distinguishes CA10 from typical carbonic anhydrases, which are known for their ability to catalyze the reversible hydration of carbon dioxide. Carbonic Anhydrase 10 Protein, Human (HEK293 ) is the recombinant human-derived Carbonic Anhydrase 10 protein, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Carbonic anhydrase 10 (CA10) protein, contrary to its name, lacks catalytic activity. This property distinguishes CA10 from typical carbonic anhydrases, which are known for their ability to catalyze the reversible hydration of carbon dioxide. Carbonic Anhydrase 10 Protein, Human (HEK293 ) is the recombinant human-derived Carbonic Anhydrase 10 protein, expressed by HEK293 , with tag free.

Background

Carbonic Anhydrase 10 (CA10) protein, based on available information, does not exhibit catalytic activity. In contrast to typical carbonic anhydrases that participate in the reversible hydration of carbon dioxide, CA10 appears to lack this enzymatic function. The absence of catalytic activity suggests that CA10 may have a distinct role, possibly serving as a structural protein or participating in non-enzymatic cellular processes. Further research is required to uncover the specific molecular functions and physiological implications associated with CA10, shedding light on its unique contributions within cellular pathways. Understanding the functional characteristics of CA10, especially in the context of its non-catalytic nature, is essential for unraveling its role in biological processes and potential relevance to health and disease. (

Species

Human

Source

HEK293

Tag

Tag Free

Accession

Q9NS85-1 (Q22-N300)

Gene ID
Molecular Construction
N-term
CA10 (Q22-N300)
Accession # Q9NS85-1
C-term
Synonyms
Carbonic anhydrase-related protein 10; CA-RP X; Cerebral protein 15; CA10
AA Sequence

MEIVWEVLFLLQANFIVCISAQQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNRDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTN

Molecular Weight

Approximately 38 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Carbonic Anhydrase 10 Protein, Human (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Carbonic Anhydrase 10 Protein, Human (HEK293)
Cat. No.:
HY-P72864
Quantity:
MCE Japan Authorized Agent: