Carbonic Anhydrase 14 Protein, Mouse (His)

Carbonic Anhydrase 14 Protein, Mouse (His) is an approximately 40.0 kDa mouse carbonic anhydrase 14 protein with a His-flag. Carbonic Anhydrase 14 is a type I membrane enzyme highly expressed in all parts of the central nervous system^[1].

Carbonic AnHYdrase XIV is a type I membrane enzyme highly expressed in all parts of the central nervous system. And it exhibits lower expression in adult liver, heart, kidney, urinary bladder, and skeletal muscle^[1].
The carbonic anhydrasekl (CA) family consists of at least 11 enzymatically active members and a few inactive homologous proteins^[2].
The carbonic anhydrases are indentified as metalloenzyme for its zinc ion prosthetic group, it can catalyze the rapid interconversion of carbon dioxide and water to bicarbonate and protons. They also take part in maintaining acid-base balance in blood and other tissues^[2].

Mouse

E. coli

N-6*His

Q9WVT6 (A16-M290)

23831  [NCBI]

HHHHHHADGGHHWTYEGPHGQDHWPTSYPECGGDAQSPINIQTDSVIFDPDLPAVQPHGYDQLGTEPLDLHNNGHTVQLSLPPTLHLGGLPRKYTAAQLHLHWGQRGSLEGSEHQINSEATAAELHVVHYDSQSYSSLSEAAQKPQGLAVLGILIEVGETENPAYDHILSRLHEIRYKDQKTSVPPFSVRELFPQQLEQFFRYNGSLTTPPCYQSVLWTVFNRRAQISMGQLEKLQETLSSTEEDPSEPLVQNYRVPQPLNQRTIFASFIQAGPLYTTGEM

Approximately 40.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. K Fujikawa-Adachi, et al. Human carbonic anhydrase XIV (CA14): cDNA cloning, mRNA expression, and mapping to chromosome 1. Genomics. 1999 Oct 1;61(1):74-81.  [Content Brief]

  [2]. D Hewett-Emmett, et al. Functional diversity, conservation, and convergence in the evolution of the alpha-, beta-, and gamma-carbonic anhydrase gene families. Mol Phylogenet Evol  [Content Brief]