1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Lyases (EC 4) Carbonic Anhydrase
  4. Carbonic Anhydrase 4 (CA IV)
  5. Carbonic Anhydrase 4 Protein, Human (His)

Carbonic Anhydrase 4 Protein, Human (His)

Cat. No.: HY-P7720
SDS Handling Instructions

Carbonic Anhydrase 4 Protein, Human (His) a recombinant Mouse Carbonic Anhydrase 4 produced in E. coli, has a His tag at the N-terminus. The Carbonic Anhydrase 4 (CA4) protein is a zinc metalloenzyme that catalyzes the reversible hydration and dehydration of CO2 and HCO3-.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock
10 μg $165 Ask For Quote & Lead Time
50 μg $496 Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Carbonic Anhydrase 4 Protein, Human (His) a recombinant Mouse Carbonic Anhydrase 4 produced in E. coli, has a His tag at the N-terminus. The Carbonic Anhydrase 4 (CA4) protein is a zinc metalloenzyme that catalyzes the reversible hydration and dehydration of CO2 and HCO3-[1].

Background

The human carbonic anhydrase IV (CA4) gene, located on chromosome 17q22, was the first identified membrane-bound isozyme in the 16-member carbonic anhydrase (CA) gene family and contains 1,170 base pairs. The CA4 enzyme is involved in the formation of gastric acid and participates in acid-base homeostasis. CA4 is expressed in normal human stomach tissues. CA4 may serve an important role in gastric cancer (GC) tumorigenesis by inhibiting cellular proliferation via regulating the expression of cell cycle‑associated proteins. CA4 may serve as a diagnostic biomarker and a potential therapeutic target in GC[1].

Species

Human

Source

E. coli

Tag

C-6*His

Accession

P22748 (A19-K283)

Gene ID

762  [NCBI]

Molecular Construction
N-term
CA4 (A19-K283)
Accession # P22748
6*His
C-term
Synonyms
rHuCarbonic Anhydrase 4, His; Carbonic Anhydrase 4; Carbonate Dehydratase IV; Carbonic Anhydrase IV; CA4
AA Sequence

AESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKHHHHHH

Molecular Weight

Approximately 30.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References

Carbonic Anhydrase 4 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Carbonic Anhydrase 4 Protein, Human (His)
Cat. No.:
HY-P7720
Quantity:
MCE Japan Authorized Agent: