1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Lyases (EC 4) Carbonic Anhydrase
  4. Carbonic Anhydrase 8 ( CA-VIII)
  5. Carbonic Anhydrase VIII/CA8 Protein, Mouse (His)

Carbonic Anhydrase VIII/CA8 Protein, Mouse (His)

Cat. No.: HY-P76765
SDS COA Handling Instructions

Despite its name, the carbonic anhydrase VIII (CA8) protein lacks carbonic anhydrase catalytic activity. This distinguishes CA8 from its typical functions related to carbonic anhydrase, an enzyme known for its ability to catalyze the reversible hydration of carbon dioxide. Carbonic Anhydrase VIII/CA8 Protein, Mouse (His) is the recombinant mouse-derived Carbonic Anhydrase VIII/CA8 protein, expressed by E. coli , with C-His labeled tag. The total length of Carbonic Anhydrase VIII/CA8 Protein, Mouse (His) is 291 a.a., with molecular weight of ~35 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Despite its name, the carbonic anhydrase VIII (CA8) protein lacks carbonic anhydrase catalytic activity. This distinguishes CA8 from its typical functions related to carbonic anhydrase, an enzyme known for its ability to catalyze the reversible hydration of carbon dioxide. Carbonic Anhydrase VIII/CA8 Protein, Mouse (His) is the recombinant mouse-derived Carbonic Anhydrase VIII/CA8 protein, expressed by E. coli , with C-His labeled tag. The total length of Carbonic Anhydrase VIII/CA8 Protein, Mouse (His) is 291 a.a., with molecular weight of ~35 kDa.

Background

Carbonic Anhydrase VIII (CA8) protein, in accordance with available information, lacks carbonic anhydrase catalytic activity, distinguishing it from other members of the carbonic anhydrase enzyme family. Notably, CA8 is expressed exclusively in Purkinje cells, emphasizing its cell-specific distribution within the central nervous system. The absence of catalytic activity in CA8 suggests that its role may extend beyond the classical enzymatic functions associated with carbonic anhydrases. The unique expression pattern in Purkinje cells indicates a specialized role for CA8 in these neurons, warranting further investigation into its specific molecular and physiological functions within this distinct cellular context. Elucidating the role of CA8 in Purkinje cells may provide valuable insights into its contributions to neuronal processes and potential implications for neurological functions. (

Biological Activity

Measured by its ability to hydrolyze 4-nitrophenyl acetate to 4-nitrophenol per minute. The specific activity is 396.0323 pmoL/min/mg.

Species

Mouse

Source

E. coli

Tag

C-6*His

Accession

P28651 (M1-Q291)

Gene ID
Molecular Construction
N-term
CA8 (M1-Q291)
Accession # P28651
His
C-term
Synonyms
Carbonic Anhydrase-Related Protein; CARP; Carbonic Anhydrase VIII; CA8; CALS
AA Sequence

MADLSFIEDAVAFPEKEEDEEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGQEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQMQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ

Molecular Weight

Approximately 35 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Carbonic Anhydrase VIII/CA8 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Carbonic Anhydrase VIII/CA8 Protein, Mouse (His)
Cat. No.:
HY-P76765
Quantity:
MCE Japan Authorized Agent: