Carbonic Anhydrase VIII/CA8 Protein, Mouse (His)

Despite its name, the carbonic anhydrase VIII (CA8) protein lacks carbonic anhydrase catalytic activity. This distinguishes CA8 from its typical functions related to carbonic anhydrase, an enzyme known for its ability to catalyze the reversible hydration of carbon dioxide. Carbonic Anhydrase VIII/CA8 Protein, Mouse (His) is the recombinant mouse-derived Carbonic Anhydrase VIII/CA8 protein, expressed by E. coli , with C-His labeled tag. The total length of Carbonic Anhydrase VIII/CA8 Protein, Mouse (His) is 291 a.a., with molecular weight of ~35 kDa.

Carbonic Anhydrase VIII (CA8) protein, in accordance with available information, lacks carbonic anhydrase catalytic activity, distinguishing it from other members of the carbonic anhydrase enzyme family. Notably, CA8 is expressed exclusively in Purkinje cells, emphasizing its cell-specific distribution within the central nervous system. The absence of catalytic activity in CA8 suggests that its role may extend beyond the classical enzymatic functions associated with carbonic anhydrases. The unique expression pattern in Purkinje cells indicates a specialized role for CA8 in these neurons, warranting further investigation into its specific molecular and physiological functions within this distinct cellular context. Elucidating the role of CA8 in Purkinje cells may provide valuable insights into its contributions to neuronal processes and potential implications for neurological functions. (

Measured by its ability to hydrolyze 4-nitrophenyl acetate to 4-nitrophenol per minute. The specific activity is 396.0323 pmoL/min/mg.

Mouse

E. coli

C-6*His

P28651 (M1-Q291)

12319  [NCBI]

MADLSFIEDAVAFPEKEEDEEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGQEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQMQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ

Approximately 35 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.