1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Cardiac phospholamban/PLN, Human (P.pastoris, GST)

Cardiac phospholamban/PLN, Human (P.pastoris, GST)

Cat. No.: HY-P72275
SDS COA Handling Instructions Technical Support

Cardiac phospholamban (PLN) strictly regulates ATP2A2 in the cardiac sarcoplasmic reticulum, reversibly inhibits ATPase activity and affects myocardial contractility. Modulation of PLN reduces the affinity of ATPase for Ca(2+), thereby affecting calcium reuptake during muscle relaxation and maintaining cardiac calcium homeostasis. Cardiac phospholamban/PLN, Human (P.pastoris, GST) is the recombinant human-derived Cardiac phospholamban/PLN, expressed by P. pastoris , with N-GST labeled tag. The total length of Cardiac phospholamban/PLN, Human (P.pastoris, GST) is 52 a.a., with molecular weight of ~33.1 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Cardiac phospholamban (PLN) strictly regulates ATP2A2 in the cardiac sarcoplasmic reticulum, reversibly inhibits ATPase activity and affects myocardial contractility. Modulation of PLN reduces the affinity of ATPase for Ca(2+), thereby affecting calcium reuptake during muscle relaxation and maintaining cardiac calcium homeostasis. Cardiac phospholamban/PLN, Human (P.pastoris, GST) is the recombinant human-derived Cardiac phospholamban/PLN, expressed by P. pastoris , with N-GST labeled tag. The total length of Cardiac phospholamban/PLN, Human (P.pastoris, GST) is 52 a.a., with molecular weight of ~33.1 kDa.

Background

Cardiac phospholamban (PLN) is a key regulator that reversibly inhibits the activity of ATP2A2 in the cardiac sarcoplasmic reticulum by decreasing the apparent affinity of the ATPase for Ca(2+). This modulation of ATP2A2 by PLN significantly influences the contractility of the heart muscle in response to physiological stimuli, impacting calcium re-uptake during muscle relaxation and playing a crucial role in maintaining calcium homeostasis within the heart muscle. The extent of ATP2A2 inhibition is contingent on the oligomeric state of PLN, and phosphorylation of PLN alleviates ATP2A2 inhibition. PLN also exerts control over intracellular Ca(2+) levels in elongated spermatids, suggesting a potential role in germ cell differentiation. As a homopentamer, PLN interacts with various proteins, including HAX1, ATP2A2, VMP1, and S100A1, contributing to its multifaceted regulatory functions in cellular processes.

Species

Human

Source

P. pastoris

Tag

N-GST

Accession

P26678 (M1-L52)

Gene ID
Molecular Construction
N-term
GST
PLN (M1-L52)
Accession # P26678
C-term
Synonyms
Cardiac phospholamban; CMD1P; CMH18
AA Sequence

MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL

Molecular Weight

Approximately 33.1kDa

Purity
  • Greater than 97% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, 3% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Cardiac phospholamban/PLN, Human (P.pastoris, GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cardiac phospholamban/PLN, Human (P.pastoris, GST)
Cat. No.:
HY-P72275
Quantity:
MCE Japan Authorized Agent: