Cardiotrophin-1/CTF1 Protein, Human (CHO)

Cardiotrophin-1/CTF1 Protein, Human (CHO), a member of IL-6 family of cytokines, is a key regulator of energy homeostasis and of glucose and lipid metabolism.

Cardiotrophin (CT)-1 belongs to the IL-6 family of cytokines^[1]. Cardiotrophin-1 (CT1) plays an important role in the differentiation, development, and survival of neural stem cells. CT1 plays a key role in neural tissue development and has survival-promoting, anti-apoptotic effects in neural injury or death. CT1 induces a phenotypic switch in sympathetic neurons and promotes the survival of dopaminergic neurons from the central nervous system and ciliary neurons from the periphery^[2].

The ED₅₀ is <0.4 ng/mL as measured by TF-1 cells.

Human

CHO

Tag Free

Q16619 (S2-A201)

1489  [NCBI]

SRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA

24-26 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against PBS.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. López-Yoldi M, et al. Role of cardiotrophin-1 in the regulation of metabolic circadian rhythms and adipose core clock genes in mice and characterization of 24-h circulating CT-1 profiles in normal-weight and overweight/obese subjects. FASEB J. 2017 Apr;31(4):1639-1649.  [Content Brief]

  [2]. Peng L, et al. Cardiotrophin-1 stimulates the neural differentiation of human umbilical cord blood-derived mesenchymal stem cells and survival of differentiated cells through PI3K/Akt-dependent signaling pathways. Cytotechnology. 2017 Dec;69(6):933-941.  [Content Brief]