1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Neurotrophic Factors
  4. Cardiotrophin-1
  5. Cardiotrophin-1/CTF1 Protein, Human (CHO)

Cardiotrophin-1/CTF1 Protein, Human (CHO), a member of IL-6 family of cytokines, is a key regulator of energy homeostasis and of glucose and lipid metabolism.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg Get quote
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Cardiotrophin-1/CTF1 Protein, Human (CHO), a member of IL-6 family of cytokines, is a key regulator of energy homeostasis and of glucose and lipid metabolism.

Background

Cardiotrophin (CT)-1 belongs to the IL-6 family of cytokines[1]. Cardiotrophin-1 (CT1) plays an important role in the differentiation, development, and survival of neural stem cells. CT1 plays a key role in neural tissue development and has survival-promoting, anti-apoptotic effects in neural injury or death. CT1 induces a phenotypic switch in sympathetic neurons and promotes the survival of dopaminergic neurons from the central nervous system and ciliary neurons from the periphery[2].

Biological Activity

The ED50 is <0.4 ng/mL as measured by TF-1 cells.

Species

Human

Source

CHO

Tag

Tag Free

Accession

Q16619 (S2-A201)

Gene ID
Molecular Construction
N-term
CTF1 (S2-A201)
Accession # Q16619
C-term
Synonyms
rHuCT-1; CTF1
AA Sequence

SRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA

Molecular Weight

24-26 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Cardiotrophin-1/CTF1 Protein, Human (CHO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cardiotrophin-1/CTF1 Protein, Human (CHO)
Cat. No.:
HY-P7149
Quantity:
MCE Japan Authorized Agent: