Cardiotrophin-1/CTF1 Protein, Rat

Cardiotropin-1/CTF1 protein plays a key role in inducing cardiomyocyte hypertrophy in vitro. Its effects on myocardial development and enlargement are mediated through binding and activation of ILST/gp130 receptors. Cardiotrophin-1/CTF1 Protein, Rat is the recombinant rat-derived Cardiotrophin-1/CTF1 protein, expressed by E. coli , with tag free. The total length of Cardiotrophin-1/CTF1 Protein, Rat is 203 a.a., with molecular weight of ~21.4 kDa.

Cardiotrophin-1/CTF1 protein takes on a pivotal role as it induces hypertrophy in cardiac myocytes in vitro, emphasizing its influence on cellular processes associated with heart muscle development and enlargement. The protein's functional impact is mediated through its binding to and activation of the ILST/gp130 receptor, revealing a specific molecular pathway through which Cardiotrophin-1/CTF1 exerts its effects. This interaction underscores its significance in signaling cascades related to cardiac myocyte responses, providing insights into the regulatory mechanisms that contribute to the modulation of cardiac hypertrophy.

1.Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 0.5 ng/mL, corresponding to a specific activity of >2.0x10⁶ IU/mg.
2.Measured in a cell proliferation assay using CTF1 human erythroleukemic cells. The ED50 for this effect is 5.936 ng/mL, corresponding to a specific activity is 1.685×10^5 units/mg.

Rat

E. coli

Tag Free

Q63086 (M1-A203)

29201  [NCBI]

MSQREGSLEDHQTDSSFSFLPHLEAKIRQTHNLARLLTKYADQLLEEYVQQQGEPFGLPGFSPPRLPLAGLSGPAPSHAGLPVSERLRQDAAALSALPALLDAVRRRQAELNPRAPRLLRSLEDAARQVRALGAAVETVLAALGAAARGPVPEPVATSALFTSNSAAGVFSAKVLGLHVCGLYGEWVSRTEGDLGQLVPGGVA

Approximately 21.4 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.