Carnosine Dipeptidase 1/CNDP1 Protein, Human (HEK293, His)

Carnosine Dipeptidase 1 Protein, Human (HEK293, His) is a human carnosine dipeptidase 1 protein with a his-flag, expressed in HEK293 cells. Carnosine Dipeptidase 1 is a member of the M20 metalloprotease family, encoded by the CNDP1 gene^[1].

Carnosine Dipeptidase 1 (CNDP1) is a member of the M20 metalloprotease family, a 57 kDa protein encoded by the CNDP1 gene. In humans, CNDP1 is secreted from the liver into the serum. In other mammals, CNDP1 is expressed exclusively within the kidney and lacks a signal peptide^[1].
The function of CNDP1 is not fully defined, but it displays carboxy-and dipeptidase activity and its main substrates appear to be the dipeptides carnosine (β-alanyl-histidine) and homocarnosine (γ-aminobutyryl-L-histidine). Furthermore, this protein is shown to be reduced in metastatic prostate cancer and glioblastoma^[1][2].

Measured by its ability to cleave carnosine (beta -Ala-L-His) in a two-step assay. The specific activity is 186.51 pmol/min/µg, as measured under the described conditions.

Human

HEK293

C-6*His

Q96KN2 (S27-L506)

84735  [NCBI]

SPSPPPALLEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFRMMAVAADTLQRLGARVASVDMGPQQLPDGQSLPIPPIILAELGSDPTKGTVCFYGHLDVQPADRGDGWLTDPYVLTEVDGKLYGRGATDNKGPVLAWINAVSAFRALEQDLPVNIKFIIEGMEEAGSVALEELVEKEKDRFFSGVDYIVISDNLWISQRKPAITYGTRGNSYFMVEVKCRDQDFHSGTFGGILHEPMADLVALLGSLVDSSGHILVPGIYDEVVPLTEEEINTYKAIHLDLEEYRNSSRVEKFLFDTKEEILMHLWRYPSLSIHGIEGAFDEPGTKTVIPGRVIGKFSIRLVPHMNVSAVEKQVTRHLEDVFSKRNSSNKMVVSMTLGLHPWIANIDDTQYLAAKRAIRTVFGTEPDMIRDGSTIPIAKMFQEIVHKSVVLIPLGAVDDGEHSQNEKINRWNYIEGTKLFAAFFLEMAQLHHHHHHH

60-90 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filter solution of 20 mM Tris-HCl, 150 mM NaCl, pH 7.5.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. Michael Teufel, et al. Sequence identification and characterization of human carnosinase and a closely related non-specific dipeptidase. J Biol Chem  [Content Brief]

  [2]. Peter Arner, et al. Circulating carnosine dipeptidase 1 associates with weight loss and poor prognosis in gastrointestinal cancer. PLoS One. 2015 Apr 21;10(4):e0123566.  [Content Brief]