Caspase-10/CASP10 Protein, Human (His)

Caspase-10 Protein, Human (His) is an approximately 33.0 kDa caspase-10 protein with a His-flag, expressed in E. coli. Caspase-10 belongs to the caspase family and involved in the execution-phase of cell apoptosis^[1].

Caspase-10 (CASP10) is a 521 amino acid protein member of the cysteine-aspartic acid protease (caspase) family. Caspase-10 contains two DED (Death Effector) domains and can be detected in many tissues^[1].
Caspases are a family of cytosolic aspartate-specific cysteine proteases involved in the execution-phase of cell apoptosis, CASP10 is cleaved to two active subunits: Caspase-10 subunit p23/17, Caspase-10 subunit p12^[2].
Caspase-10 belongs to the apoptosis initiation caspase (caspase-2, -8, -9, -and -10). Caspase-10 cleavage activates caspases 3 and 7, but itself is processed by caspase 8^[3].

Human

E. coli

C-6*His

Q92851-4 (V220-R472)

843  [NCBI]

VKTFLEALPQESWQNKHAGSNGNRATNGAPSLVSRGMQGASANTLNSETSTKRAAVYRMNRNHRGLCVIVNNHSFTSLKDRQGTHKDAEILSHVFQWLGFTVHIHNNVTKVEMEMVLQKQKCNPAHADGDCFVFCILTHGRFGAVYSSDEALIPIREIMSHFTALQCPRLAEKPKLFFIQACQGEEIQPSVSIEADALNPEQAPTSLQDSIPAEADFLLGLATVPGYVSFRHVEEGSWYIQSLCNHLKKLVPRHEDILSIHHHHHH

Approximately 33.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. Katherine Wachmann, et al. Activation and specificity of human caspase-10. Biochemistry. 2010 Sep 28;49(38):8307-15.  [Content Brief]

  [2]. Sebastian Horn, et al. Caspase-10 Negatively Regulates Caspase-8-Mediated Cell Death, Switching the Response to CD95L in Favor of NF-κB Activation and Cell Survival. Cell Rep. 2017 Apr 25;19(4):785-797.  [Content Brief]

  [3]. Andrea Mohr, et al. Caspase-10: a molecular switch from cell-autonomous apoptosis to communal cell death in response to chemotherapeutic drug treatment. Cell Death Differ. 2018 Feb;25(2):340-352.  [Content Brief]