Caspase-8/CASP8 subunit p18 Protein, Human (His)

The Caspase-8/CASP8 subunit p18 protein is a key thiol protease that acts as a molecular switch in programmed cell death processes, including apoptosis, necroptosis, and pyroptosis. It is essential for preventing tissue damage by inducing exogenous apoptosis by cleaving and activating effector caspases. Caspase-8/CASP8 subunit p18 Protein, Human (His) is the recombinant human-derived Caspase-8/CASP8 subunit p18 protein, expressed by E. coli , with N-6*His labeled tag. The total length of Caspase-8/CASP8 subunit p18 Protein, Human (His) is 158 a.a., with molecular weight of ~21.9 kDa.

Caspase-8/CASP8 subunit p18 Protein, a pivotal thiol protease, serves as a molecular switch orchestrating programmed cell death processes such as apoptosis, necroptosis, and pyroptosis. Essential for preventing tissue damage during embryonic development and adulthood, this initiator protease induces extrinsic apoptosis by cleaving and activating effector caspases, including CASP3, CASP4, CASP6, CASP7, CASP9, and CASP10. Acting as the initiator in death-inducing signaling complexes (DISC) formed in response to TNFRSF6/FAS or TNFRSF1A signals, it liberates the active dimeric enzyme, enabling downstream apoptotic protease activation. Additionally, Caspase-8 negatively regulates necroptosis by cleaving RIPK1 and functions as a regulator of pyroptosis, initiating the cleavage and activation of gasdermin-C and -D. This multifaceted protease plays a role in innate immunity by cleaving and inactivating N4BP1 downstream of TLR3 or TLR4, promoting cytokine production. While lacking a catalytic site, Caspase-8 may interfere with the pro-apoptotic activity of the complex.

Caspase-8/CASP8 subunit p18 Protein, Human (His) lacks of Caspase-8 enzyme activity because it contains only one subunit.

Human

E. coli

N-6*His

Q14790 (S217-D374)

841  [NCBI]

SESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETD

Approximately 21.9 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.