Cathepsin B Protein, Rat (HEK293, His)

Cathepsin B is a lysosomal cysteine protease that plays a role in intracellular protein catabolism. Cathepsin B mediates JNK signaling pathway to regulate the migration of glioma initiation cells. Cathepsin B is involved in the pathology of chronic inflammatory diseases of the airway and joints, as well as cancer and pancreatitis. Cathepsin B Protein, Rat (HEK293, His) is the recombinant rat-derived Cathepsin B protein, expressed by HEK293 , with C-His labeled tag. The total length of Cathepsin B Protein, Rat (HEK293, His) is 322 a.a., with molecular weight of 35-43 kDa.

Cathepsin B is a lysosomal cysteine protease that plays a role in intracellular protein catabolism and is involved in other physiological processes such as antigen processing in immune response, hormone activation, and bone turnover. Cathepsin B mediates JNK signaling pathway to regulate the migration of glioma initiation cells. Cathepsin B can enhance the activity of other proteases, including matrix metalloproteinases, urokinase (serine protease urokinase plasminogen activator), and Cathepsin D. Cathepsin B is involved in the pathology of chronic inflammatory diseases of the airway and joints, as well as cancer and pancreatitis^[1][2][3].

Measured by its ability to cleave the fluorogenic peptide substrate Z-LR-AMC . The specific activity is >2,500 pmol/min/μg.

Rat

HEK293

C-6*His

Q6IN22 (H18-F339)

64529  [NCBI]

HDKPSFHPLSDDMINYINKQNTTWQAGRNFYNVDISYLKKLCGTVLGGPKLPERVGFSEDINLPESFDAREQWSNCPTIAQIRDQGSCGSCWAFGAVEAMSDRICIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWNFWTRKGLVSGGVYNSHIGCLPYTIPPCEHHVNGSRPPCTGEGDTPKCNKMCEAGYSTSYKEDKHYGYTSYSVSDSEKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDVMGGHAIRILGWGIENGVPYWLVANSWNVDWGDNGFFKILRGENHCGIESEIVAGIPRTQQYWGRF

Approximately 35-43 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 25 mM Tris, 150 mM NaCl, pH 7.5. or PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.