1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3) Cathepsin
  4. Cathepsin D
  5. Cathepsin D Protein, Cricetulus griseus (His-SUMO)

Cathepsin D Protein, Cricetulus griseus (His-SUMO)

Cat. No.: HY-P72155
Handling Instructions Technical Support

Cathepsin D is an intracellular aspartic protease of the pepsin superfamily. Cathepsin D is synthesized on the rough endoplasmic reticulum as a pre-pro-enzyme. Cathepsin D is sorted to the lysosomal compartments mainly by M-6-P pathway. Cathepsin D Protein, Cricetulus griseus (His-SUMO) is the recombinant Cathepsin D protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag. The total length of Cathepsin D Protein, Cricetulus griseus (His-SUMO) is 344 a.a., with molecular weight of ~53.3 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Cathepsin D is an intracellular aspartic protease of the pepsin superfamily. Cathepsin D is synthesized on the rough endoplasmic reticulum as a pre-pro-enzyme. Cathepsin D is sorted to the lysosomal compartments mainly by M-6-P pathway. Cathepsin D Protein, Cricetulus griseus (His-SUMO) is the recombinant Cathepsin D protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag. The total length of Cathepsin D Protein, Cricetulus griseus (His-SUMO) is 344 a.a., with molecular weight of ~53.3 kDa.

Background

Cathepsin D is over-expressed and hyper-secreted by epithelial breast cancer cells. Cathepsin D is an independent marker of poor prognosis in breast cancer. Cathepsin D is also a key mediator of induced-apoptosis and its proteolytic activity has been involved generally in this event[1].

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Others

Source

E. coli

Tag

N-6*His;N-SUMO

Accession

G3I4W7 (G65-L408)

Gene ID

100766628  [NCBI]

Molecular Construction
N-term
6*His-SUMO
Cathepsin D (G65-L408)
Accession # G3I4W7
C-term
Synonyms
Cathepsin D; H671_3g9701
AA Sequence

GPVSELLKNYLDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSGKSSTFVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSEQPGGLKVEKQIFGEAIKQPGITFIAAKFDGILGMGYPSISVNNVVPVFDNLMQQKLVEKNIFSFFLNRDPTGQPGGELMLGGIDSKYYEGELSYLNVTRKAYWQVHMDQLDVANGLTLCKGGCEAIVDTGTSLLVGPVDEVKELQKAIGAVPLIQGEYMIPCEKVSSLPSVTLKLGGKDYELSPSKYVLKVSQGGKTICLSGFMGMDIPPPSGPLWILGDVFIGTYYTVFDRDNNRVGFAKAATL

Molecular Weight

Approximately 53.3 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

Cathepsin D Protein, Cricetulus griseus (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cathepsin D Protein, Cricetulus griseus (His-SUMO)
Cat. No.:
HY-P72155
Quantity:
MCE Japan Authorized Agent: