1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3) Cathepsin
  4. Cathepsin D
  5. Cathepsin D Protein, Mouse (HEK293, His)

Cathepsin D Protein, Mouse (HEK293, His) is an approximately 56.0 kDa mouse cathepsin D with a His tag. Cathepsin D is a lysosomal aspartic protease of the pepsin family.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Cathepsin D Protein, Mouse (HEK293, His) is an approximately 56.0 kDa mouse cathepsin D with a His tag. Cathepsin D is a lysosomal aspartic protease of the pepsin family[1].

Background

Cathepsin D, a lysosomal aspartic protease, belongs to the pepsin family. Mouse Cathepsin D consists of a signal peptide (residues 120), a propeptide (residues 2164), and a mature chain (residues 65410) (13). Cathepsin D is expressed in most cells and overexpressed in in some cancer (breast, melanoma, ovary, etc.). Cathepsin D increases the incidence of clinical metastasis involves increased cell growth and decreased contact inhibition rather than escape of cancer cells through the basement membrane[1][2].
Cathepsin D acts as a protease following its activation at an acidic pH, or as a ligand of different membrane receptors at a more neutral pH[1].

Biological Activity

Measured by its ability to cleave a peptide substrate, Mca-PLGL-Dpa-AR-NH2. Read at excitation and emission wavelengths of 320 nm and 405 nm (top read). The specific activity is 5026.88 pmol/min/µg, as measured under the described conditions.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

P18242 (I21-L410)

Gene ID
Molecular Construction
N-term
Cathepsin D (I21-L410)
Accession # P18242
6*His
C-term
Synonyms
rMuCathepsin D, His; Cathepsin D; CTSD; CPSD
AA Sequence

IIRIPLRKFTSIRRTMTEVGGSVEDLILKGPITKYSMQSSPKTTEPVSELLKNYLDAQYYGDIGIGTPPQCFTVVFDTGSSNLWVPSIHCKILDIACWVHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSDQSKARGIKVEKQIFGEATKQPGIVFVAAKFDGILGMGYPHISVNNVLPVFDNLMQQKLVDKNIFSFYLNRDPEGQPGGELMLGGTDSKYYHGELSYLNVTRKAYWQVHMDQLEVGNELTLCKGGCEAIVDTGTSLLVGPVEEVKELQKAIGAVPLIQGEYMIPCEKVSSLPTVYLKLGGKNYELHPDKYILKVSQGGKTICLSGFMGMDIPPPSGPLWILGDVFIGSYYTVFDRDNNRVGFANAVVLHHHHHH

Molecular Weight

Approximately 46 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.  
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM MES, 150 mM NaCl, pH 5.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Cathepsin D Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cathepsin D Protein, Mouse (HEK293, His)
Cat. No.:
HY-P7749
Quantity:
MCE Japan Authorized Agent: