Cathepsin E Protein, Human (HEK293, His)

Cathepsin E Protein, Human (HEK293, His) is a human cathepsin E with a His tag. Cathepsin E is an aspartic protease and a member of the peptidase A1 family of proteases.^[1].

Cathepsin E is an aspartic protease and a member of the peptidase A1 family of proteases. As an intracellular, hydrolytic aspartic protease, Cathepsin E is mainly expressed in cells of the immune and gastrointestinal systems, lymphoid tissues, erythrocytes, and cancer cells^[1].
Cathepsin E functions by breaking down proteins through the hydrolysis of peptide bonds at a specific peptide sequence site. And Cathepsin E plays an important role in the degradation of proteins, the generation of bioactive proteins, and antigen processing^[2].
Human Cathepsin E is synthesized as a precursor protein, consisting of a signal peptide (residues 117), a propeptide (residues 1853), and a mature chain (residues 54396)^[3].

Measured by its ability to cleave 40μM fluorogenic peptide substrate Mca-PLGL-Dpa-AR-NH2 that incubated at room temperature for 30min. The specific activity is 14784.79 pmol/min/ug.

Human

HEK293

C-6*His

P14091 (S20-P396)

1510  [NCBI]

SLHRVPLRRHPSLKKKLRARSQLSEFWKSHNLDMIQFTESCSMDQSAKEPLINYLDMEYFGTISIGSPPQNFTVIFDTGSSNLWVPSVYCTSPACKTHSRFQPSQSSTYSQPGQSFSIQYGTGSLSGIIGADQVSVEGLTVVGQQFGESVTEPGQTFVDAEFDGILGLGYPSLAVGGVTPVFDNMMAQNLVDLPMFSVYMSSNPEGGAGSELIFGGYDHSHFSGSLNWVPVTKQAYWQIALDNIQVGGTVMFCSEGCQAIVDTGTSLITGPSDKIKQLQNAIGAAPVDGEYAVECANLNVMPDVTFTINGVPYTLSPTAYTLLDFVDGMQFCSSGFQGLDIHPPAGPLWILGDVFIRQFYSVFDRGNNRVGLAPAVPHHHHHH

Approximately 42-48 kDa

Greater than 95% as determined by reducing SDS-PAGE.    

Lyophilized powder.

Lyophilized after extensive dialysis against 20 mM MES, 150 mM NaCl, pH 5.5.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. T Tsukuba, et al. New functional aspects of cathepsin D and cathepsin E. Mol Cells  [Content Brief]

  [2]. F Grüninger-Leitch, et al. Identification of beta-secretase-like activity using a mass spectrometry-based assay system. Nat Biotechnol. 2000 Jan;18(1):66-70.  [Content Brief]

  [3]. T Azuma, et al. Human gastric cathepsin E. Predicted sequence, localization to chromosome 1, and sequence homology with other aspartic proteinases. J Biol Chem  [Content Brief]