1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3) Cathepsin
  4. Cathepsin H
  5. Cathepsin H Protein, Mouse (HEK293, His)

Cathepsin H Protein, Mouse (HEK293, His)

Cat. No.: HY-P7752
COA Handling Instructions

Cathepsin H Protein, Mouse (HEK293, His) is an approximately 36-40 kDa cathepsin H protein with a His-flag. Cathepsin H is a lysosomal cysteine protease of the papain family.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $80 In-stock
10 μg $136 In-stock
50 μg $380 In-stock
100 μg $646 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Cathepsin H Protein, Mouse (HEK293, His) is an approximately 36-40 kDa cathepsin H protein with a His-flag. Cathepsin H is a lysosomal cysteine protease of the papain family[1].

Background

Cathepsin H is a lysosomal cysteine protease belongs to the papain family. Cathepsin H is synthesized as a precursor protein, consisting of a signal peptide (residues 120), a propeptide (residues 21-95), a mini chain (residues 96-103), a heavy chain (residues 114-290) and a light chain (residues 291-333)[1].

Biological Activity

Measured by its ability to cleave the fluorogenic peptide substrate, Arg-7-amido-4-methylcoumarin (R-AMC). The specific activity is >700 pmol/min/μg.

Species

Mouse

Source

HEK293

Tag

C-His

Accession

AAA82966.1 (A21-V333)

Gene ID
Molecular Construction
N-term
Cathepsin H (A21-V333)
Accession # AAA82966.1
His
C-term
Synonyms
rMuCathepsin H, His; Pro-cathepsin H; CTSH; ACC-4; ACC-5; aleurain; cathepsin B3; cathepsin BA; cathepsin H; CPSB;
AA Sequence

AELTVNAIEKFHFKSWMKQHQKTYSSVEYNHRLQMFANNWRKIQAHNQRNHTFKMALNQFSDMSFAEIKHKFLWSEPQNCSATKSNYLRGTGPYPSSMDWRKKGNVVSPVKNQGACASCWTFSTTGALESAVAIASGKMLSLAEQQLVDCAQAFNNHGCKGGLPSQAFEYILYNKGIMEEDSYPYIGKDSSCRFNPQKAVAFVKNVVNITLNDEAAMVEAVALYNPVSFAFEVTEDFLMYKSGVYSSKSCHKTPDKVNHAVLAVGYGEQNGLLYWIVKNSWGSQWGENGYFLIERGKNMCGLAACASYPIPQV

Molecular Weight

Approximately 42 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Cathepsin H Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cathepsin H Protein, Mouse (HEK293, His)
Cat. No.:
HY-P7752
Quantity:
MCE Japan Authorized Agent: