Cathepsin K Protein, Mouse (His)

Cathepsin K protein is a thiol protease that is critical in osteoclastic bone resorption and exhibits potent endoprotease activity against fibrinogen under acidic conditions. Its potential role in extracellular matrix degradation is noteworthy. Cathepsin K Protein, Mouse (His) is the recombinant mouse-derived Cathepsin K protein, expressed by E. coli , with N-6*His labeled tag. The total length of Cathepsin K Protein, Mouse (His) is 215 a.a., with molecular weight of ~31 kDa.

Cathepsin K Protein, a thiol protease, is integral to osteoclastic bone resorption and exhibits potent endoprotease activity against fibrinogen under acidic conditions. Additionally, it may play a significant role in extracellular matrix degradation (By similarity). Notably, Cathepsin K is involved in the release of thyroid hormone thyroxine (T4) through limited proteolysis of TG/thyroglobulin in the thyroid follicle lumen, as demonstrated by studies. This dual functionality underscores its importance in bone metabolism and extracellular matrix dynamics, as well as its specific involvement in the regulated release of thyroid hormones.

Measured by its ability to cleave the fluorogenic peptide substrate, Z-Gly-Pro-Arg-MCA.The specific activity is 1949.534 pmol/min/µg, as measured under the described conditions.

Mouse

E. coli

N-6*His

P55097 (V115-M329)

13038  [NCBI]

VPDSIDYRKKGYVTPVKNQGQCGSCWAFSSAGALEGQLKKKTGKLLALSPQNLVDCVTENYGCGGGYMTTAFQYVQQNGGIDSEDAYPYVGQDESCMYNATAKAAKCRGYREIPVGNEKALKRAVARVGPISVSIDASLASFQFYSRGVYYDENCDRDNVNHAVLVVGYGTQKGSKHWIIKNSWGESWGNKGYALLARNKNNACGITNMASFPKM

Approximately 31 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm solution of 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.