1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3) Cathepsin
  4. Cathepsin X/Cathepsin Z
  5. Cathepsin Z/CTSZ Protein, Human (HEK293, C-His)

Cathepsin Z/CTSZ Protein, Human (HEK293, C-His)

Cat. No.: HY-P7758A
SDS COA Handling Instructions Technical Support

Cathepsin Z/CTSZ Protein exhibits dual carboxy-monopeptidase and carboxy-dipeptidase activities, as evidenced by research. Additionally, it displays functional versatility by generating kinin potentiating peptides. Cathepsin Z/CTSZ Protein, Human (HEK293, C-His) is the recombinant human-derived Cathepsin Z/CTSZ protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Cathepsin Z/CTSZ Protein, Human (HEK293, C-His) is 280 a.a., with molecular weight of 37-40 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Cathepsin Z/CTSZ Protein exhibits dual carboxy-monopeptidase and carboxy-dipeptidase activities, as evidenced by research. Additionally, it displays functional versatility by generating kinin potentiating peptides. Cathepsin Z/CTSZ Protein, Human (HEK293, C-His) is the recombinant human-derived Cathepsin Z/CTSZ protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Cathepsin Z/CTSZ Protein, Human (HEK293, C-His) is 280 a.a., with molecular weight of 37-40 kDa.

Background

Cathepsin Z/CTSZ Protein demonstrates both carboxy-monopeptidase and carboxy-dipeptidase activities, as indicated in research. It also possesses the ability to generate kinin potentiating peptides, showcasing its functional versatility.

Biological Activity

Measured by its ability to cleave the fluorogenic peptide substrate, MCA-Arg-Pro-Pro-Gly-Phe-Ser-Ala-Phe-Lys(DNP)-OH. The specific activity is 3210.6 pmol/min/µg, as measured under the described conditions.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q9UBR2 (G24-V303)

Gene ID

1522

Molecular Construction
N-term
CTSZ (G24-V303)
Accession # Q9UBR2
6*His
C-term
Synonyms
rHuCathepsin X, His; Cathepsin Z; Cathepsin P; Cathepsin X; CTSZ
AA Sequence

GLYFRRGQTCYRPLRGDGLAPLGRSTYPRPHEYLSPADLPKSWDWRNVDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSVQNVIDCGNAGSCEGGNDLSVWDYAHQHGIPDETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERLANYTGGIYAEYQDTTYINHVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTYKDGKGARYNLAIEEHCTFGDPIVHHHHHH

Molecular Weight

37-40 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Cathepsin Z/CTSZ Protein, Human (HEK293, C-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cathepsin Z/CTSZ Protein, Human (HEK293, C-His)
Cat. No.:
HY-P7758A
Quantity:
MCE Japan Authorized Agent: