1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Lyases (EC 4)
  4. CBS Protein, Human (His)

CBS, a hydro-lyase, initiates the transsulfuration pathway by catalyzing the beta-replacement reaction, converting L-serine to L-cystathionine using L-homocysteine. This process eliminates L-methionine and the potentially harmful metabolite L-homocysteine. CBS, beyond its catabolic role, contributes to hydrogen sulfide production, serving as a gasotransmitter with signaling and cytoprotective effects, particularly on neurons. CBS Protein, Human (His) is the recombinant human-derived CBS protein, expressed by E. coli , with N-6*His labeled tag. The total length of CBS Protein, Human (His) is 550 a.a., with molecular weight of ~64.5 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg Get quote
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CBS, a hydro-lyase, initiates the transsulfuration pathway by catalyzing the beta-replacement reaction, converting L-serine to L-cystathionine using L-homocysteine. This process eliminates L-methionine and the potentially harmful metabolite L-homocysteine. CBS, beyond its catabolic role, contributes to hydrogen sulfide production, serving as a gasotransmitter with signaling and cytoprotective effects, particularly on neurons. CBS Protein, Human (His) is the recombinant human-derived CBS protein, expressed by E. coli , with N-6*His labeled tag. The total length of CBS Protein, Human (His) is 550 a.a., with molecular weight of ~64.5 kDa.

Background

CBS, a hydro-lyase, plays a pivotal role in initiating the transsulfuration pathway by catalyzing the beta-replacement reaction where the hydroxyl group of L-serine is substituted by L-homocysteine, leading to the formation of L-cystathionine—a precursor to L-cysteine. This enzymatic process facilitates the elimination of L-methionine and the potentially harmful metabolite L-homocysteine. Beyond its role in catabolism, CBS is also integral to the production of hydrogen sulfide, serving as a gasotransmitter with both signaling and cytoprotective effects, particularly on neurons.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P35520 (P2-K551)

Gene ID

875  [NCBI]

Molecular Construction
N-term
6*His
CBS (P2-K551)
Accession # P35520
C-term
Synonyms
AI047524; AI303044; Beta thionase; Beta-thionase; Cbs; Cbs cystathionine beta-synthase; CBS_HUMAN; Cystathionine beta synthase; Cystathionine beta-synthase; EC 4.2.1.22; HIP 4; HIP4; Methylcysteine synthase; MGC18856; MGC18895; MGC37300; OTTHUMP00000109416; OTTHUMP00000109418; Serine sulfhydrase
AA Sequence

PSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQK

Molecular Weight

Approximately 64.5 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm solution of PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

CBS Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CBS Protein, Human (His)
Cat. No.:
HY-P72118
Quantity:
MCE Japan Authorized Agent: