TARC/CCL17 Protein, Rat (His)

CCL17 protein is a chemokine with selective chemotactic activity towards Th2 cells and plays a crucial role in various inflammatory and immune processes. It coordinates immune responses by binding to CCR4 on the surface of T cells. TARC/CCL17 Protein, Rat (His) is the recombinant rat-derived TARC/CCL17 protein, expressed by E. coli , with N-6*His labeled tag.

The CCL17 protein functions as a chemokine, demonstrating chemotactic activity for T lymphocytes, particularly favoring Th2 cells over monocytes or granulocytes. This specificity underscores its crucial role in a diverse array of inflammatory and immunological processes. Operating through the binding to CCR4 on the T-cell surface, CCL17 actively participates in orchestrating immune responses. Additionally, CCL17 plays a role in mediating GM-CSF/CSF2-driven pain and inflammation, and in the brain, it is indispensable for maintaining the typical highly branched morphology of hippocampal microglia under homeostatic conditions. Moreover, CCL17 may be pivotal for the appropriate adaptation of microglial morphology and synaptic plasticity in response to acute lipopolysaccharide (LPS)-induced neuroinflammation. Furthermore, CCL17 contributes to wound healing by inducing fibroblast migration into the wound, further highlighting its multifaceted involvement in immune regulation and tissue repair processes.

1.Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 1.0-10 ng/mL.
2.Measured by its ability to chemoattract Jurkat cells. The ED₅₀ for this effect is approximately 0.6155 ng/mL, corresponding to a specific activity is 1.62×10⁶ U/mg.

• 
  Measured by its ability to chemoattract Jurkat cells. The ED₅₀ for this effect is approximately 0.6155 ng/mL, corresponding to a specific activity is 1.62×10⁶ U/mg.

Rat

E. coli

N-6*His

Q9ERE0 (A24-L93)

117518  [NCBI]

ARATNVGRECCLDYFKGAIPIRKLVTWFRTSVECPKDAIVFETVQGRLICTDPKDKHVKKAIRHLKNQRL

Approximately 12 kDa

• 
  Measured by its ability to chemoattract Jurkat cells. The ED₅₀ for this effect is approximately 0.6155 ng/mL, corresponding to a specific activity is 1.62×10⁶ U/mg.

Lyophilized powder

Lyophilized from a 0.2 μm solution of PBS, pH 7.4 or 50 mM Tris-HCL, 300 mM NaCl, 200 mM arginine, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.