1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. RANTES/CCL5
  6. RANTES/CCL5 Protein, Human

RANTES/CCL5 Protein is a secreted protein located outside the cell membrane and is a key pro-inflammatory chemokine and immune regulatory molecule in the CC chemokine family. RANTES/CCL5 Protein sends signals through its specific G protein-coupled receptors (GPCR) CCR1, CCR3, and CCR5, mediating inflammatory immune responses, viral infections, and tumor development. RANTES/CCL5 Protein can promote endothelial cell migration, proliferation, and angiogenesis in rats. RANTES/CCL5 Protein is useful for research into tumors, autoimmune diseases, and atherosclerosis. RANTES/CCL5 Protein, Human is a recombinant human CCL5 (S24-S91) protein expressed by E. coli.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg Get quote
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

RANTES/CCL5 Protein is a secreted protein located outside the cell membrane and is a key pro-inflammatory chemokine and immune regulatory molecule in the CC chemokine family. RANTES/CCL5 Protein sends signals through its specific G protein-coupled receptors (GPCR) CCR1, CCR3, and CCR5, mediating inflammatory immune responses, viral infections, and tumor development. RANTES/CCL5 Protein can promote endothelial cell migration, proliferation, and angiogenesis in rats. RANTES/CCL5 Protein is useful for research into tumors, autoimmune diseases, and atherosclerosis. RANTES/CCL5 Protein, Human is a recombinant human CCL5 (S24-S91) protein expressed by E. coli[1][2].

Background

CCL5, also known as RANTES (Regulated upon Activation, Normal T Cell Expressed and Secreted), is part of the CC subfamily of chemokines. The CCL5 gene is located in the q11.2-q12 region of human chromosome 17 and encodes a CCL5 protein with a molecular weight of 8 kDa[1].
RANTES/CCL5 Protein can be secreted by many cell types, such as platelets, endothelial cells, smooth muscle cells, macrophages, and activated T cells[1].
RANTES/CCL5 Protein can induce the expression of MMP-1 and MMP-13 in human rheumatoid arthritis synovial fibroblasts by utilizing heparan sulfate proteoglycans (HSPGs) and/or selectively activating PKCδ, JNK, and ERK proteins in the PKCδ-JNK/ERK pathway, ultimately leading to collagen degradation[3].
RANTES/CCL5 Protein promotes angiogenesis by binding to GPCR, CCR1, and CCR5, as well as to its proteoglycan receptors SDC-1, SDC-4, and CD-44, and it partially relies on VEGF secreted by endothelial cells[1].
RANTES/CCL5 Protein is induced by the relevant cytokine IL-13 in mice infected with RSV, leading to airway hyperreactivity (AHR) and worsening airway diseases[4].
RANTES/CCL5 Protein interacts with CCR5, increasing the phosphorylation of MEK and ERK in the MEK/ERK pathway, activating NF-κB, leading to the activation of αvβ3 integrin and promoting the migration of human osteosarcoma cells[5].
The oligomeric form of RANTES/CCL5 Protein is important for some of its functions. RANTES/CCL5 Protein can form larger aggregates in neutral pH environments, while it forms smaller aggregates when the pH is lowered[6].
RANTES/CCL5 Protein is associated with various pathological processes, including viral infections, atherosclerosis, inflammatory diseases, autoimmune diseases, and tumors[1].

In Vitro

RANTES/CCL5 Protein (1 or 10 nM, 25 days) induces angiogenesis in a rat intervertebral disc angiogenesis model[1].
RANTES/CCL5 Protein (100 ng/mL, 24 h) can activate the expression of MMP-1 and MMP-13 in human rheumatoid arthritis synovial fibroblasts, thereby inducing collagen degradation[3].
RANTES/CCL5 Protein (3 ng/mL, 24 h) can promote the expression of α v β 3 integrin and cell migration in human osteosarcoma cells[6].
Reduced mTOR activity in RANTES/CCL5 Protein expression-deficient Rantes KO stem/progenitor cells results in a younger haematopoietic stem cell phenotype[7].

In Vivo

RANTES/CCL5 Protein is induced to produce in primary respiratory syncytial virus infected mice, exacerbating airway diseases[4].
Lack of expression of RANTES/CCL5 Protein in Rantes gene knockout (KO) mice can lead to a decrease in myeloid biased HSCs and myeloid progenitor cells, as well as an increase in T cells and lymphoid biased HSCs[7].

Biological Activity

1.Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood monocytes is in a concentration range of 1.0-10.0 ng/mL.
2.Measured by its ability to chemoattract THP-1 cells. The ED50 for this effect is 2.640-4.751 ng/mL.

  • Measured by its ability to chemoattract THP-1 cells. The ED50 for this effect is 4.751 ng/mL, corresponding to a specific activity is 2.105×105 U/mg.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

P13501 (S24-S91)

Gene ID
Molecular Construction
N-term
CCL5 (S24-S91)
Accession # P13501
C-term
Synonyms
C-C Motif Chemokine 5; EoCP; Eosinophil Chemotactic Cytokine; SIS-Delta; Small-Inducible Cytokine A5; T Cell-Specific Protein P228; TCP228; T-Cell-Specific Protein RANTES; CCL5; D17S136E; SCYA5
AA Sequence

SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS

Molecular Weight

7-12 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Citrate, 6% Trehalose, 4% Mannitol, 0.05% Tween 80, pH 4.0 or 4mM HCL, pH 2.5 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

RANTES/CCL5 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RANTES/CCL5 Protein, Human
Cat. No.:
HY-P70450
Quantity:
MCE Japan Authorized Agent: