CCN2/CTGF Protein, Human (His)

CCN2/CTGF Protein, secreted by vascular endothelial cells, crucially promotes chondrocyte proliferation and differentiation, and mediates heparin- and divalent cation-dependent cell adhesion in diverse cell types. Additionally, it enhances fibroblast growth factor-induced DNA synthesis while existing as a monomer and interacting with TSKU. CCN2/CTGF Protein, Human (His) is the recombinant human-derived CCN2/CTGF protein, expressed by E. coli , with N-6*His labeled tag. The total length of CCN2/CTGF Protein, Human (His) is 97 a.a., with molecular weight of ~15.1 kDa.

CCN2/CTGF protein, a major connective tissue mitoattractant, is secreted by vascular endothelial cells. It plays a crucial role in promoting the proliferation and differentiation of chondrocytes. Additionally, CCN2/CTGF mediates heparin- and divalent cation-dependent cell adhesion in various cell types, including fibroblasts, myofibroblasts, endothelial cells, and epithelial cells. Furthermore, it enhances fibroblast growth factor-induced DNA synthesis. CCN2/CTGF exists as a monomer and interacts with TSKU.

Human

E. coli

N-6*His

P29279 (G253-A349)

1490  [NCBI]

GKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTTLPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA

Approximately 15.1 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm solution of 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.