1. Recombinant Proteins
  2. Others
  3. NOV/CCN3 Protein, Mouse (HEK293, His)

The NOV/CCN3 protein is an early player that coordinates diverse cellular processes such as proliferation, adhesion, migration, differentiation, and survival.By interacting with membrane receptors such as integrins or NOTCH1, it regulates hematopoietic stem cells and inhibits myogenic differentiation while affecting the expression of cell cycle regulators.NOV/CCN3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived NOV/CCN3 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The NOV/CCN3 protein is an early player that coordinates diverse cellular processes such as proliferation, adhesion, migration, differentiation, and survival.By interacting with membrane receptors such as integrins or NOTCH1, it regulates hematopoietic stem cells and inhibits myogenic differentiation while affecting the expression of cell cycle regulators.NOV/CCN3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived NOV/CCN3 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

NOV/CCN3 protein, functioning as an immediate-early participant, plays a pivotal role in a diverse array of cellular processes encompassing proliferation, adhesion, migration, differentiation, and survival. Operating through binding interactions with integrins or membrane receptors such as NOTCH1, NOV/CCN3 emerges as an essential regulator of hematopoietic stem and progenitor cell function. It inhibits myogenic differentiation by activating the Notch-signaling pathway and curtails vascular smooth muscle cells proliferation independently of TGFB1 signaling, influencing the expression of cell-cycle regulators like CDKN2B or CDKN1A. As a ligand for integrins ITGAV:ITGB3 and ITGA5:ITGB1, NOV/CCN3 directly stimulates pro-angiogenic activities, induces angiogenesis, and supports endothelial cell adhesion, migration, and survival. Additionally, it plays roles in cutaneous wound healing, skin fibroblast adhesion, and chemotaxis through interactions with various integrin pairs. Moreover, NOV/CCN3 contributes to bone regeneration, negatively regulating the articular chondrocytic phenotype while repressing endochondral ossification. It also affects pancreatic beta-cell function, acting as a negative regulator by inhibiting beta-cell proliferation and insulin secretion. Functioning as a negative regulator of endothelial pro-inflammatory activation, it reduces monocyte adhesion and exerts anti-inflammatory effects by inhibiting the NF-kappaB signaling pathway. NOV/CCN3 further contributes to the control of inflammatory processes in atherosclerosis and attenuates inflammatory pain through the regulation of IL1B- and TNF-induced MMP9, MMP2, and CCL2 expression, inhibiting MMP9 expression through engagement with ITGB1. It engages in diverse protein interactions, including FBLN1, NOTCH1, GJA1/CX43, ITGA5:ITGB1, ITGAV:ITGB3, ITGAV:ITGB5, and ZDHHC22, potentially leading to CCN3 palmitoylation. The breadth of these interactions underscores the intricate and multifaceted role of NOV/CCN3 in cellular processes and regulatory pathways.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q64299 (S26-I354)

Gene ID
Molecular Construction
N-term
CCN3 (S26-I354)
Accession # Q64299
6*His
C-term
Synonyms
Protein NOV homolog; NovH; CCN family member 3; Nephroblastoma-overexpressed gene protein homolog; Nov
AA Sequence

SLRCPSRCPPKCPSISPTCAPGVRSVLDGCSCCPVCARQRGESCSEMRPCDQSSGLYCDRSADPNNQTGICMVPEGDNCVFDGVIYRNGEKFEPNCQYFCTCRDGQIGCLPRCQLDVLLPGPDCPAPRKVAVPGECCEKWTCGSDEQGTQGTLGGLALPAYRPEATVGVEVSDSSINCIEQTTEWSACSKSCGMGVSTRVTNRNRQCEMVKQTRLCIVRPCEQEPEEVTDKKGKKCLRTKKSLKAIHLQFENCTSLYTYKPRFCGVCSDGRCCTPHNTKTIQVEFQCLPGEIIKKPVMVIGTCTCYSNCPQNNEAFLQDLELKTSRGEI

Molecular Weight

Approximately 50.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

NOV/CCN3 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NOV/CCN3 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P71149
Quantity:
MCE Japan Authorized Agent: