CD105/Endoglin Protein, Mouse (HEK293, His)

CD105/Endoglin is an important endothelial glycoprotein that controls angiogenesis and ensures the structural integrity of the adult vasculature. It affects vascular endothelial cell migration and has important implications for extraembryonic and embryonic heart development. CD105/Endoglin Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD105/Endoglin protein, expressed by HEK293 , with C-His labeled tag. The total length of CD105/Endoglin Protein, Mouse (HEK293, His) is 554 a.a., with molecular weight of 65-70 kDa.

CD105/Endoglin, a vascular endothelium glycoprotein, plays a crucial role in angiogenesis regulation, contributing to the normal structure and integrity of adult vasculature. Essential for maintaining the structural integrity of the vasculature, CD105/Endoglin also influences the migration of vascular endothelial cells. Its significance extends to extraembryonic angiogenesis and embryonic heart development, underscoring its essential role in vascular development. CD105/Endoglin may modulate endothelial cell responses to blood flow, impacting vascular remodeling and the establishment of normal vascular morphology during angiogenesis. Functioning as a TGF-beta coreceptor, it is involved in the TGF-beta/BMP signaling cascade, leading to the activation of SMAD transcription factors. Furthermore, CD105/Endoglin interacts with various molecules, including TGFB1, GDF2, ACVRL1, BMP10, DYNLT4, and ARRB2, highlighting its multifaceted involvement in cellular processes. The protein forms homodimers through disulfide linkages and engages in heteromeric complexes with TGF-beta signaling receptors. Additionally, CD105/Endoglin binds TGFB1 and TGFB2 with high affinity, further emphasizing its intricate role in molecular interactions.

Measured by its ability to inhibit BMP9-induced alkaline phosphatase production by MC3T3E1 mouse chondrogenic cells. The ED₅₀ for this effect is typically 25-100 ng/mL in the presence of 2 ng/mL of recombinant human BMP9.

Mouse

HEK293

C-His

Q63961 (R28-G581)

13805  [NCBI]

MDRGVLPLPITLLFVIYSFVPTTGLAERVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVFLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTPVQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVSWFIDINHSMQILTTGEYSVKIFPGSKVKGVELPDTPQGLIAEARKLNASIVTSFVELPLVSNVSLRASSCGGVFQTTPAPVVTTPPKDTCSPVLLMSLIQPKCGNQVMTLALNKKHVQTLQCTITGLTFWDSSCQAEDTDDHLVLSSAYSSCGMKVTAHVVSNEVIISFPSGSPPLRKKVQCIDMDSLSFQLGLYLSPHFLQASNTIELGQQAFVQVSVSPLTSEVTVQLDSCHLDLGPEGDMVELIQSRTAKGSCVTLLSPSPEGDPRFSFLLRVYMVPTPTAGTLSCNLALRPSTLSQEVYKTVSMRLNIVSPDLSGKG

65-70 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.