1. Recombinant Proteins
  2. CD Antigens
  3. Stem Cell CD Proteins
  4. CD133
  5. CD133/PROM1 Protein, Rat (HEK293, Fc)

The CD133/PROM1 protein is critical for multiple processes including glomerular epithelial cell differentiation and retinal morphogenesis, showing biased expression in tissues such as lung and kidney. CD133/PROM1 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD133/PROM1 protein, expressed by HEK293 , with N-mFc labeled tag. The total length of CD133/PROM1 Protein, Rat (HEK293, Fc) is 254 a.a., with molecular weight of ~70-95 KDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CD133/PROM1 protein is critical for multiple processes including glomerular epithelial cell differentiation and retinal morphogenesis, showing biased expression in tissues such as lung and kidney. CD133/PROM1 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD133/PROM1 protein, expressed by HEK293 , with N-mFc labeled tag. The total length of CD133/PROM1 Protein, Rat (HEK293, Fc) is 254 a.a., with molecular weight of ~70-95 KDa.

Background

CD133/PROM1 Protein is predicted to possess actinin binding activity, cadherin binding activity, and cholesterol binding activity. The protein is anticipated to be involved in various processes, including glomerular epithelial cell differentiation, photoreceptor cell maintenance, and retina morphogenesis in camera-type eyes. Predicted to be located in cellular components such as the endoplasmic reticulum-Golgi intermediate compartment, extracellular exosome, and photoreceptor outer segment membrane, CD133 is expected to be active in cellular components like the apical plasma membrane, microvillus, and prominosome. Additionally, it is predicted to be an integral component of the plasma membrane. CD133 is used in the study of diabetes mellitus and is implicated in human conditions such as cone-rod dystrophy 12 and retinitis pigmentosa 41. Notably, CD133 exhibits biased expression in tissues, with prominent levels observed in the lung, kidney, and eight other tissues, suggesting its diverse functional roles in these organs.

Species

Rat

Source

HEK293

Tag

N-mFc

Accession

NP_001103607.1 (N171-Y424)

Gene ID
Molecular Construction
N-term
mFc
CD133 (N171-Y424)
Accession # NP_001103607.1
C-term
Synonyms
Prominin-1; Antigen AC133; CD133; PROM1; PROML1; MSTP061
AA Sequence

NQQTRTRIQRTQKLAESNYRDLRALLTEAPKQIDYILGQYNTTKNKAFSDLDSIDSVLGGRIKGQLKPKVTPVLEEIKAMATAIRQTKDALQNMSSSLKSLRDASTQLSTNLTSVRNSIENSLNSNDCASDPASKICDSLRPQLSNLGSNHNGSQLQSVDRELNTVNDVDRTDLESLVKRGYMSIDEIPNMIQNQTGDVIKDVKKTLDSVSSKVKNMSQSIPVEEVLLQFSHYLNDSNRYIHESLPRVEEYDSY

Molecular Weight

Approximately 70-95 kDa.

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CD133/PROM1 Protein, Rat (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD133/PROM1 Protein, Rat (HEK293, Fc)
Cat. No.:
HY-P76197
Quantity:
MCE Japan Authorized Agent: