1. Recombinant Proteins
  2. Cytokines and Growth Factors Immune Checkpoint Proteins CD Antigens
  3. TNF Superfamily Stimulatory Immune Checkpoint Molecules T Cell CD Proteins Macrophage CD Proteins Stem Cell CD Proteins Dendritic Cell CD Proteins
  4. TNF Receptor Superfamily 4-1BB
  5. 4-1BB
  6. CD137/4-1BB Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc)

CD137/4-1BB Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc)

Cat. No.: HY-P7810
Handling Instructions Technical Support

CD137/4-1BB Protein lacks conserved residue(s) crucial for feature annotation propagation. CD137/4-1BB Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc) is the recombinant cynomolgus-derived CD137/4-1BB protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD137/4-1BB Protein lacks conserved residue(s) crucial for feature annotation propagation. CD137/4-1BB Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc) is the recombinant cynomolgus-derived CD137/4-1BB protein, expressed by HEK293 , with C-hFc labeled tag.

Background

CD137/4-1BB Protein exhibits a lack of conserved residue(s) essential for the propagation of feature annotation.

In Vitro

4-1BB (Cynomolgus monkey) binds to STA551, and Uto-hIgG2 with Kd value of 25.1 nM and 130 nM, respectively[4].

Species

Rhesus Macaque; Cynomolgus

Source

HEK293

Tag

C-hFc

Accession

A9YYE7/F6W5G6 (L24-Q186)

Gene ID

102127961  [NCBI]/708281

Molecular Construction
N-term
4-1BB (L24-Q186)
Accession # A9YYE7
hFc
C-term
Synonyms
rCynCD137/4-1BB, Fc; CD137; ILA; TNFRSF9; 4-1BB ligand receptor; CDw137; T-cell antigen 4-1BB homolog; T-cell antigen ILA
AA Sequence

LQDLCSNCPAGTFCDNNRSQICSPCPPNSFSSAGGQRTCDICRQCKGVFKTRKECSSTSNAECDCISGYHCLGAECSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSATPPAPAREPGHSPQ

Molecular Weight

Approximately 60.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CD137/4-1BB Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD137/4-1BB Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc)
Cat. No.:
HY-P7810
Quantity:
MCE Japan Authorized Agent: