CD14 Protein, Cynomolgus (HEK293, His)

CD14 protein is a key coreceptor that cooperates with LBP to bind LPS and deliver it to the LY96/TLR4 complex to generate an immune response. CD14 activates NF-kappa-B through MyD88, TIRAP and TRAF6, triggering inflammation and cytokine release. CD14 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD14 protein, expressed by HEK293 , with C-His labeled tag. The total length of CD14 Protein, Cynomolgus (HEK293, His) is 344 a.a., with molecular weight of 45-56 kDa.

CD14 Protein serves as a key coreceptor for bacterial lipopolysaccharide (LPS), collaborating with LBP to bind monomeric LPS and deliver it to the LY96/TLR4 complex, thereby orchestrating the innate immune response. Operating through MyD88, TIRAP, and TRAF6, CD14 activates NF-kappa-B, triggering cytokine release and inflammation. It also functions as a coreceptor for TLR2:TLR6 and TLR2:TLR1 heterodimers in response to diacylated and triacylated lipopeptides, respectively. Additionally, CD14 binds electronegative LDL, mediating cytokine release induced by LDL(-). As a member of the lipopolysaccharide (LPS) receptor complex, which includes CD14, LY96, and TLR4, CD14 interacts with LPAR1, highlighting its versatile roles in immune and signaling pathways.

Measured by its ability to enhance LPS-stimulated IL-8 secretion by THP-1 human acute monocytic leukemia cells. The ED₅₀ for this effect is 1.202 ng/mL, corresponding to a specific activity is 8.319×10⁵ U/mg.

Cynomolgus

HEK293

C-6*His

B3Y6B8 (T20-M344)

697482  [NCBI]

TTPEPCELDDEDFRCVCNFSEPHPDWSEAFQCVSAVEVEIRVGGLSLEPFLTRVDPDADPRQYADTIKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLQELTLEDLEITGTMPPLPLEATGLALSSLRLHNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLIAALCPHKFPALQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATANPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRRPRPDELPQVDNLALDGNPFLVPGTALPQEGSM

Approximately 45-56 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.