Fc gamma RIII/CD16 Protein, Mouse (HEK293, His)

Fc gamma RIII/CD16 Protein, a low-affinity receptor for IgG1, IgG2a, and IgG2b, is crucial for mediating neutrophil activation in response to IgG complexes. It functions redundantly with Fcgr4 and interacts with INPP5D/SHIP1, emphasizing its involvement in intracellular signaling pathways linked to immune responses. Fc gamma RIII/CD16's significance lies in facilitating cellular activation triggered by immunoglobulin binding. Fc gamma RIII/CD16 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Fc gamma RIII/CD16 protein, expressed by HEK293 , with C-6*His labeled tag.

The Fc gamma RIII/CD16 Protein serves as a low-affinity receptor for the Fc region of complexed immunoglobulins gamma, specifically binding to IgG1, IgG2a, and IgG2b. This receptor plays a crucial role in mediating neutrophil activation in response to IgG complexes, functioning redundantly with Fcgr4 in this process. The interaction with INPP5D/SHIP1 further highlights its involvement in intracellular signaling pathways associated with immune responses, underscoring its significance in facilitating cellular activation triggered by immunoglobulin binding.

Mouse

HEK293

C-6*His

P08508 (A31-T215)

14131  [NCBI]

ALPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHT

35-40 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.