1. Recombinant Proteins
  2. CD Antigens
  3. Macrophage CD Proteins
  4. PSGL-1/CD162
  5. CD162/PSGL-1 Protein, Human (HEK293, hFc)

CD162/PSGL-1 Protein, Human (HEK293, hFc)

Cat. No.: HY-P72485
SDS COA Handling Instructions

CD162/PSGL-1 Protein, a cell surface receptor, plays a crucial role in leukocyte trafficking and adhesion. Dysregulation of CD162/PSGL-1 Protein has been associated with inflammatory diseases and impaired immune responses. Targeting CD162/PSGL-1 Protein may offer potential therapeutic interventions in these conditions by modulating leukocyte trafficking, enhancing immune responses, and managing inflammatory disorders. CD162/PSGL-1 Protein, Human (HEK293, hFc) is the recombinant human-derived CD162/PSGL-1 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg $145 In-stock
50 μg $400 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD162/PSGL-1 Protein, a cell surface receptor, plays a crucial role in leukocyte trafficking and adhesion. Dysregulation of CD162/PSGL-1 Protein has been associated with inflammatory diseases and impaired immune responses. Targeting CD162/PSGL-1 Protein may offer potential therapeutic interventions in these conditions by modulating leukocyte trafficking, enhancing immune responses, and managing inflammatory disorders. CD162/PSGL-1 Protein, Human (HEK293, hFc) is the recombinant human-derived CD162/PSGL-1 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

CD162/PSGL-1 Protein is a SLe(x)-type proteoglycan that plays a crucial role in inflammation. It facilitates the rapid rolling of leukocytes over vascular surfaces during the initial stages of inflammation by interacting with E-, P-, and L-selectins through high affinity, calcium-dependent interactions. CD162/PSGL-1 Protein is essential for the initial capture of leukocytes. In addition to its role in inflammation, it also acts as a receptor for enterovirus 71 during microbial infection.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q14242 (Q42-G295)

Gene ID
Molecular Construction
N-term
PSGL-1 (Q42-G295)
Accession # Q14242
hFc
C-term
Synonyms
P-selectin glycoprotein ligand 1; PSGL-1; Selectin P ligand; CD162; SELPLG
AA Sequence

QATEYEYLDYDFLPETEPPEMLRNSTDTTPLTGPGTPESTTVEPAARRSTGLDAGGAVTELTTELANMGNLSTDSAAMEIQTTQPAATEAQTTQPVPTEAQTTPLAATEAQTTRLTATEAQTTPLAATEAQTTPPAATEAQTTQPTGLEAQTTAPAAMEAQTTAPAAMEAQTTPPAAMEAQTTQTTAMEAQTTAPEATEAQTTQPTATEAQTTPLAAMEALSTEPSATEALSMEPTTKRGLFIPFSVSSVTHKG

Molecular Weight

100-130 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris,150 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CD162/PSGL-1 Protein, Human (HEK293, hFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD162/PSGL-1 Protein, Human (HEK293, hFc)
Cat. No.:
HY-P72485
Quantity:
MCE Japan Authorized Agent: