CD19 Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc)

CD19 is a signaling component of the B-cell receptor complex that lowers the threshold for antigen-driven activation. CD19 Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived CD19 protein, expressed by HEK293 , with C-hFc labeled tag.

CD19 is a signaling component of the B-cell receptor complex and a regulator that drives B-cell differentiation and germinal center (GC) formation by lowering the threshold for antigen-driven activation. CD19 forms a complex with multiple membrane proteins, including complement receptor type 2 (CD21) and tetraspanin (CD81), thereby lowering the threshold for antigen-primed B cell activation. The CD19 complex then activates the phosphatidylinositol 3-kinase signaling pathway and subsequently releases intracellular stored calcium ions. CD19 is used in chimeric antigen receptor (CAR) T cells to treat lymphocytic leukemia. Anti-CD19 CAR-T cell approaches have been used to treat B-cell malignancies and play a key role in systemic lupus erythematosus (SLE), where B-cell activation is dysregulated. CD19 also has a biological relationship with coronaviruses and may be involved in immune responses or antiviral activities.

Rhesus Macaque

HEK293

C-hFc

F7F486 (P20-K292)

705211  [NCBI]

PQEPLVVKVEEGDNAVLQCLEGTSDGPTQQLVWCRDSPFEPFLNLSLGLPGMGIRMGPLGIWLLIFNVSNQTGGFYLCQPGLPSEKAWQPGWTVSVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLNSSQLYVWAKDRPEMWEGEPVCGPPRDSLNQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVRPKGPKSSLLSLELKDDRPDRDMWVVDTGLLLTRATAQDAGKYYCHRGNWTKSFYLEITARPALWHWLLRIGGWK

80-110 kDa

Greater than 95% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.