1. Recombinant Proteins
  2. CAR-T Related Proteins CD Antigens
  3. B Cell CD Proteins Macrophage CD Proteins Stem Cell CD Proteins Dendritic Cell CD Proteins
  4. CD20
  5. CD20/MS4A1 Protein, Mouse (P.pastoris, His)

CD20/MS4A1 Protein, Mouse (P.pastoris, His)

Cat. No.: HY-P71758
SDS COA Handling Instructions

CD20/MS4A1 protein regulates cellular calcium influx, essential for B-lymphocyte development, differentiation, and activation. It activates store-operated calcium channels, allowing calcium influx through B-cell receptor/BCR activation. CD20/MS4A1 protein forms homotetramers and interacts with cell surface IgM chains, the antigen-binding parts of the BCR. CD20/MS4A1 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived CD20/MS4A1 protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of CD20/MS4A1 Protein, Mouse (P.pastoris, His) is 181 a.a., with molecular weight (glycosylation form) of ~33 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

CD20/MS4A1 Protein, Mouse (P.pastoris, His) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD20/MS4A1 protein regulates cellular calcium influx, essential for B-lymphocyte development, differentiation, and activation. It activates store-operated calcium channels, allowing calcium influx through B-cell receptor/BCR activation. CD20/MS4A1 protein forms homotetramers and interacts with cell surface IgM chains, the antigen-binding parts of the BCR. CD20/MS4A1 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived CD20/MS4A1 protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of CD20/MS4A1 Protein, Mouse (P.pastoris, His) is 181 a.a., with molecular weight (glycosylation form) of ~33 kDa.

Background

CD20/MS4A1 protein is a B-lymphocyte-specific membrane protein that plays a crucial role in regulating cellular calcium influx, which is necessary for the development, differentiation, and activation of B-lymphocytes. It functions as a component of store-operated calcium (SOC) channels, promoting calcium influx upon activation by the B-cell receptor/BCR. CD20/MS4A1 protein forms homotetramers and interacts with the heavy and light chains of cell surface IgM, which are the antigen-binding components of the BCR.

Species

Mouse

Source

P. pastoris

Tag

N-6*His

Accession

P19437 (V111-P291)

Gene ID
Molecular Construction
N-term
6*His
CD20 (V111-P291)
Accession # P19437
C-term
Synonyms
Ms4a1; Cd20; Ly-44; Ms4a2; B-lymphocyte antigen CD20; B-cell differentiation antigen Ly-44; Lymphocyte antigen 44; CD antigen
AA Sequence

VIMSSLSLFAAISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP

Molecular Weight

Approximately 33 kDa.The reducing (R) protein migrat es as 33 kDa in SDS-PAGE may be due to glycosylation.

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against solution in 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 or PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD20/MS4A1 Protein, Mouse (P.pastoris, His)
Cat. No.:
HY-P71758
Quantity:
MCE Japan Authorized Agent: