1. Recombinant Proteins
  2. Immune Checkpoint Proteins Receptor Proteins
  3. Stimulatory Immune Checkpoint Molecules
  4. CD200R
  5. CD200R4
  6. CD200R4 Protein, Mouse (HEK293, His)

The CD200R4 protein significantly contributes to TYROBP receptor recruitment or surface expression, suggesting its role in immune regulation or signaling processes. Molecular interactions with TYROBP underscore the function of CD200R4, which may influence downstream cellular responses and mediate TYROBP-related signaling events. CD200R4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD200R4 protein, expressed by HEK293 , with C-His labeled tag. The total length of CD200R4 Protein, Mouse (HEK293, His) is 216 a.a., with molecular weight of ~40-75 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CD200R4 protein significantly contributes to TYROBP receptor recruitment or surface expression, suggesting its role in immune regulation or signaling processes. Molecular interactions with TYROBP underscore the function of CD200R4, which may influence downstream cellular responses and mediate TYROBP-related signaling events. CD200R4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD200R4 protein, expressed by HEK293 , with C-His labeled tag. The total length of CD200R4 Protein, Mouse (HEK293, His) is 216 a.a., with molecular weight of ~40-75 kDa.

Background

The CD200R4 Protein plays a significant role in the recruitment or surface expression of the TYROBP receptor, indicating its involvement in cellular processes related to immune regulation or signaling. The interaction with TYROBP underlines the molecular association that contributes to the functionality of CD200R4, potentially influencing downstream cellular responses. This interaction suggests a role for CD200R4 in mediating signaling events associated with TYROBP, highlighting its importance in immune modulation or other cellular activities that involve TYROBP signaling pathways.

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Mouse CD200 R4 is present at 0.5 μg/mL can bind Recombinant Mouse CD200. The ED50 for this effect is 1.23 μg/mL.

  • Measured by its binding ability in a functional ELISA. When Recombinant Mouse CD200 R4 is present at 0.5 μg/mL can bind Recombinant Mouse CD200. The ED50 for this effect is 1.23 μg/mL.
Species

Mouse

Source

HEK293

Tag

C-His

Accession

Q6XJV4 (T26-T241)

Gene ID

239849  [NCBI]

Molecular Construction
N-term
CD200R4 (T26-T241)
Accession # Q6XJV4
His
C-term
Synonyms
Cell surface glycoprotein CD200 receptor 4; CD200RLa; Cd200r4
AA Sequence

TDENQTIQNDSSSSLTQVNTTMSVQMDKKALLCCFSSPLINAVLITWIIKHRHLPSCTIAYNLDKKTNETSCLGRNITWASTPDHSPELQISAVALQHEGTYTCEIVTPEGNLEKVYDLQVLVPPEVTYFPGKNRTAVCEAMAGKPAAQISWTPDGDCVTKSESHSNGTVTVRSTCHWEQNNVSVVSCLVSHSTGNQSLSIELSQGTMTTPRSLLT

Molecular Weight

The protein migrates as an approximately 40-75 kDa band under reducing SDS-PAGE due to glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CD200R4 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD200R4 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P77318
Quantity:
MCE Japan Authorized Agent: