1. Recombinant Proteins
  2. CAR-T Related Proteins CD Antigens Receptor Proteins
  3. B Cell CD Proteins Stem Cell CD Proteins Dendritic Cell CD Proteins Siglec
  4. Siglec-2/CD22
  5. CD22 Protein, Rhesus Macaque (HEK293, His)

The Siglec-2/CD22 protein mediates B cell interactions and may direct B cell localization within lymphoid tissues.It recognizes sialylated glycoproteins, especially α-2,6-linked sialic acid, and participates in cis-interactions at the cell surface.CD22 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD22 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The Siglec-2/CD22 protein mediates B cell interactions and may direct B cell localization within lymphoid tissues.It recognizes sialylated glycoproteins, especially α-2,6-linked sialic acid, and participates in cis-interactions at the cell surface.CD22 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD22 protein, expressed by HEK293 , with C-His labeled tag.

Background

Siglec-2/CD22 Protein serves as a crucial mediator in B-cell interactions, potentially playing a role in the localization of B-cells within lymphoid tissues. Known for its ability to bind sialylated glycoproteins, including CD45, it exhibits a preference for alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. During the immune response, ligand-induced tyrosine phosphorylation suggests its involvement in the regulation of B-cell antigen receptor signaling. The protein's multifaceted role encompasses positive regulation through interaction with Src family tyrosine kinases, while concurrently acting as an inhibitory receptor by recruiting cytoplasmic phosphatases via their SH2 domains to block signal transduction through dephosphorylation of signaling molecules. Siglec-2/CD22 predominately exists as a monomer of isoform CD22-beta and can also form a heterodimer with a shorter isoform. Its intricate interactions with key molecules such as PTPN6/SHP-1, LYN, SYK, PIK3R1/PIK3R2, PLCG1, GRB2, INPP5D, and SHC1, especially upon phosphorylation, highlight its pivotal role in orchestrating complex signaling networks within B-cells. Further research is essential to unravel the precise molecular pathways and functional consequences of Siglec-2/CD22 in B-cell regulation and immune responses.

Biological Activity

Determined by its ability to inhibit the proliferation of Raji cells. The ED50 for this effect is 9.78 μg/mL, corresponding to a specific activity is 1.02×102 units/mg.

  • Determined by its ability to inhibit the proliferation of Raji cells.The ED50 for this effect is 9.78 μg/mL, corresponding to a specific activity is 1.02×102 units/mg.
Species

Rhesus Macaque

Source

HEK293

Tag

C-His

Accession

EHH29920 (S20-R686)

Gene ID

/

Molecular Construction
N-term
CD22 (M1-R686)
Accession # EHH29920
His
C-term
Synonyms
B-cell receptor CD22; BL-CAM; CD22; T-cell surface antigen Leu-14
AA Sequence

SKWNIEHPGTIYAWEGACVWVPCTYRVLDGALETFILFHNPEYNQNMSKFEGTRLYESTKDGKVPSGQKRVQFLGNKINNNCTLSIHPVHVNDSGQLGLRMVSKTEKWMERIHLNVSERPFPPRIQLPPKLQESQEVTLTCLLNFSCYGYQIQLQWLLEGVPMRQAAVTSTSLSTKSVFTRSELKFSPQWSHHGKIVTCELHDVDGKVLSEDMVQLNVKHTPKLTIEVTPNETIVRKGDSVTMTCKVNSSNPEYTTVSWLKDGIPLKEQNTLMLTLHEVTKSQSGRYCCRVSNDVGPATSEKVFLQVQYAPEPSRVQISQSPAVEGSEVNFLCISPANPLPTNYTWYHNGKEVQGRTEKQFQIQKILPWHAGTYSCEAENILGIGERGPGTELDVQYPPKKVTMVIENPTPIREGDTVTLSCNYSSSNPIVNHYEWRPRGAWEEPSLGVLKIQNIGWNNTAVACAACNNWCSWASPVTLNVLYAPRGVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQFFWEKNGSLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSQGNQVMEGKTATLICESDANPPVYSYAWFDWNNQSLPYSGRMLRLEPVKVQHSGAYWCQGTNRVGKGHSPLITLTVYYSPQTIGRR

Molecular Weight

Approximately 100-130 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD22 Protein, Rhesus Macaque (HEK293, His)
Cat. No.:
HY-P75627
Quantity:
MCE Japan Authorized Agent: