CD23/Fc epsilon RII Protein, Human (HEK293, His)

CD23 or Fc epsilon receptor II (Fc epsilon RII) is a low-affinity receptor for immunoglobulin E (IgE) and complements receptor 2 (CR2/CD21). CD23 is present on B cells, regulates IgE production and B cell differentiation, and aids in IgE-dependent antigen uptake. CD23/Fc epsilon RII Protein, Human (HEK293, His) is the recombinant human-derived CD23/Fc epsilon RII protein, expressed by HEK293 , with N-8*His labeled tag. The total length of CD23/Fc epsilon RII Protein, Human (HEK293, His) is 274 a.a., with molecular weight of 35-40 kDa.

CD23, also known as Fc epsilon receptor II (Fc epsilon RII), functions as a low-affinity receptor for immunoglobulin E (IgE) and complements receptor 2 (CR2/CD21). Playing crucial roles in the regulation of IgE production and B cell differentiation, CD23 on B cells facilitates IgE-dependent antigen uptake and presentation to T cells. In macrophages, IgE binding and antigen cross-linking trigger intracellular killing of parasites by activating the L-Arginine-nitric oxide pathway. CD23 forms homotrimers and interacts with IGHE, specifically via its C-type lectin domain, regulating IgE homeostasis. Furthermore, CD23 interacts with CR2/CD21 through its C-terminus, specifically engaging with Sushi domains 1 and 2 of CR2/CD21. These interactions underscore CD23's multifaceted involvement in immune responses, ranging from B cell activation to the macrophage-mediated defense against parasites.

Human

HEK293

N-8*His

P06734 (D48-S321)

2208  [NCBI]

DTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS

35-40 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.