1. Recombinant Proteins
  2. CD Antigens Fc Receptors
  3. B Cell CD Proteins Platelet CD Proteins Epithelial cell CD Proteins Fc-epsilon Receptor
  4. Fc epsilon RII/CD23
  5. CD23/Fc epsilon RII Protein, Rat (HEK293, Fc)

CD23, also known as Fc epsilon Receptor II (Fc epsilon RII), is a low-affinity receptor for immunoglobulin E (IgE) and complement receptor 2 (CR2/CD21). CD23 regulates IgE production and B-cell differentiation, aiding in IGE-dependent antigen uptake. CD23/Fc epsilon RII Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD23/Fc epsilon RII protein, expressed by HEK293 , with N-hFc labeled tag. The total length of CD23/Fc epsilon RII Protein, Rat (HEK293, Fc) is 282 a.a., with molecular weight of 60-75 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD23, also known as Fc epsilon Receptor II (Fc epsilon RII), is a low-affinity receptor for immunoglobulin E (IgE) and complement receptor 2 (CR2/CD21). CD23 regulates IgE production and B-cell differentiation, aiding in IGE-dependent antigen uptake. CD23/Fc epsilon RII Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD23/Fc epsilon RII protein, expressed by HEK293 , with N-hFc labeled tag. The total length of CD23/Fc epsilon RII Protein, Rat (HEK293, Fc) is 282 a.a., with molecular weight of 60-75 kDa.

Background

CD23, also known as Fc epsilon Receptor II (Fc epsilon RII), is a low-affinity receptor for immunoglobulin E (IgE) and complement receptor 2 (CR2/CD21). CD23 on B cells plays a crucial role in the regulation of IgE production and B cell differentiation, promoting the uptake and presentation of IGE-dependent antigens to T cells. In macrophages, IgE binding and antigenic crosslinking trigger the parasite's intracellular killing by activating the L-arginine-nitric oxide pathway. CD23 forms homologous trimers and interacts with IGHE, particularly through its C-type lectin domain, regulating IgE homeostasis. CD23 plays an important role in immune responses ranging from B-cell activation to macrophage-mediated parasite defense[1][2].

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Rat CD23 at 2μg/mL (100μL/well) can bind Human IgE. The ED50 for this effect is 0.5997 μg/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Rat CD23 at 2μg/mL (100μL/well) can bind Human IgE. The ED50 for this effect is 0.5997μg/mL.
Species

Rat

Source

HEK293

Tag

N-hFc

Accession

Q6AZ45 (E50-P331)

Gene ID
Molecular Construction
N-term
hFc
CD23 (E50-P331)
Accession # Q6AZ45
C-term
Synonyms
Low affinity immunoglobulin epsilon Fc receptor; BLAST-2; FCER2; CD23A
AA Sequence

ETEKSLKQLGDAAIQNVSHVTKDLQNYQSNQLAQKSQALQMSQNLEELQAEQKQMKSQDSQLSQNLNELQEDLINVKSQNSELSQNLNTLQEDLVNVKSQGLNEKRAASDSLEKLQEEVAKLWIEILMSKGTACNVCPKDWLHFQQKCYYFGEGSKQWIQAKFTCSDLEGRLVSIHSQKEQDFLMQHINKKESWIGLQDLNMEGEFVWPDGSPVGYSNWSPGEPNNGGQGEDCVMMRGSGQWNDAFCRSYLDAWVCEQLATCDLSAPLASVTPTGPTPKNEP

Molecular Weight

Approximately 60-75 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, PH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD23/Fc epsilon RII Protein, Rat (HEK293, Fc)
Cat. No.:
HY-P74320
Quantity:
MCE Japan Authorized Agent: