1. Recombinant Proteins
  2. Cytokines and Growth Factors Immune Checkpoint Proteins CD Antigens
  3. TNF Superfamily Stimulatory Immune Checkpoint Molecules T Cell CD Proteins B Cell CD Proteins NK Cell CD Proteins Macrophage CD Proteins Stem Cell CD Proteins
  4. TNF Receptor Superfamily CD27
  5. CD27/TNFRSF7 Protein, Rat (HEK293, Fc)

The CD27/TNFRSF7 protein is predicted to have endopeptidase inhibitor activity, be ethanol responsive, and be membrane localized. Its ortholog of human CD27 has been implicated in lymphoproliferative syndrome 2, emphasizing immune system regulation. CD27/TNFRSF7 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD27/TNFRSF7 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CD27/TNFRSF7 protein is predicted to have endopeptidase inhibitor activity, be ethanol responsive, and be membrane localized. Its ortholog of human CD27 has been implicated in lymphoproliferative syndrome 2, emphasizing immune system regulation. CD27/TNFRSF7 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD27/TNFRSF7 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

CD27/TNFRSF7 Protein is predicted to exhibit cysteine-type endopeptidase inhibitor activity involved in the apoptotic process and is involved in the cellular response to ethanol. This protein is primarily located in the membrane. The human ortholog(s) of this gene are implicated in lymphoproliferative syndrome 2, highlighting its role in immune system regulation. As the orthologous counterpart to human CD27 (CD27 molecule), CD27/TNFRSF7 demonstrates biased expression, with significant levels observed in the Thymus (RPKM 187.5), Spleen (RPKM 34.1), and one other tissue. This expression pattern underscores its potential involvement in immune functions, particularly within lymphoid tissues, and suggests a specialized role in modulating apoptotic processes in response to specific stimuli like ethanol.

Biological Activity

Immobilized Rat CD70 Protein at 2 µg/mL (100 µL/well) can bind Rat CD27. The ED50 for this effect is 121.9 ng/mL.

Species

Rat

Source

HEK293

Tag

C-hFc

Accession

Q501W2/NP_001019506 (T21-R183)

Gene ID
Molecular Construction
N-term
CD27 (T21-R183)
Accession # Q501W2/NP_001019506
hFc
C-term
Synonyms
CD27 antigen; T cell activation antigen CD27; T14; TNFRSF7
AA Sequence

TPAPNNCPDRHYWIGAGLCCQMCGPGTFLVKHCDQDRAAAQCDPCIPGTSFSPDYHTRPHCESCRHCNSGFLIRNCTVTANAECTCSKGWQCRDQECTECDPPLNPALTSQPSEAPSPQLPPPTHLPYATEKPSWPPQRQLPDSTVYSRLPSQRPLCSSDCIR

Molecular Weight

Approximately 60-70 kDa due to the glycosylation.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD27/TNFRSF7 Protein, Rat (HEK293, Fc)
Cat. No.:
HY-P75427
Quantity:
MCE Japan Authorized Agent: