CD27/TNFRSF7 Protein, Rat (HEK293, Fc)

The CD27/TNFRSF7 protein is predicted to have endopeptidase inhibitor activity, be ethanol responsive, and be membrane localized. Its ortholog of human CD27 has been implicated in lymphoproliferative syndrome 2, emphasizing immune system regulation. CD27/TNFRSF7 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD27/TNFRSF7 protein, expressed by HEK293 , with C-hFc labeled tag.

CD27/TNFRSF7 Protein is predicted to exhibit cysteine-type endopeptidase inhibitor activity involved in the apoptotic process and is involved in the cellular response to ethanol. This protein is primarily located in the membrane. The human ortholog(s) of this gene are implicated in lymphoproliferative syndrome 2, highlighting its role in immune system regulation. As the orthologous counterpart to human CD27 (CD27 molecule), CD27/TNFRSF7 demonstrates biased expression, with significant levels observed in the Thymus (RPKM 187.5), Spleen (RPKM 34.1), and one other tissue. This expression pattern underscores its potential involvement in immune functions, particularly within lymphoid tissues, and suggests a specialized role in modulating apoptotic processes in response to specific stimuli like ethanol.

Immobilized Rat CD70 Protein at 2 µg/mL (100 µL/well) can bind Rat CD27. The ED₅₀ for this effect is 121.9 ng/mL.

Rat

HEK293

C-hFc

Q501W2/NP_001019506 (T21-R183)

500318  [NCBI]

TPAPNNCPDRHYWIGAGLCCQMCGPGTFLVKHCDQDRAAAQCDPCIPGTSFSPDYHTRPHCESCRHCNSGFLIRNCTVTANAECTCSKGWQCRDQECTECDPPLNPALTSQPSEAPSPQLPPPTHLPYATEKPSWPPQRQLPDSTVYSRLPSQRPLCSSDCIR

Approximately 60-70 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.