CD3 epsilon Protein, Cynomolgus (HEK293, Fc)

The CD3E/CD3 epsilon 1-27 peptide is critical in the TCR-CD3 complex, transmitting signals during T cell activation. When APC activates the TCR, CD3E undergoes LCK/FYN-mediated phosphorylation together with ITAM, initiating downstream signaling. CD3 epsilon Protein, Cynomolgus (HEK293, Fc) is the recombinant cynomolgus-derived CD3 epsilon protein, expressed by HEK293 , with C-Fc, C-hFc labeled tag. The total length of CD3 epsilon Protein, Cynomolgus (HEK293, Fc) is 96 a.a., with molecular weight of 38-55 kDa.

The CD3E/CD3 epsilon 1-27 peptide, integral to the TCR-CD3 complex on T-lymphocyte cell surfaces, plays a crucial role in adaptive immune responses. Upon activation by antigen-presenting cells (APCs), the T-cell receptor (TCR) transmits signals across the cell membrane through CD3 chains, including CD3D, CD3E, CD3G, and CD3Z, each containing immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domains. Phosphorylation of these ITAMs by Src family protein tyrosine kinases LCK and FYN, upon TCR engagement, activates downstream signaling pathways. Beyond its role in signal transduction, CD3E is indispensable for correct T-cell development, initiating the assembly of the TCR-CD3 complex by forming heterodimers CD3D/CD3E and CD3G/CD3E. Additionally, CD3E participates in the internalization and cell surface down-regulation of TCR-CD3 complexes through endocytosis sequences in its cytosolic region. The TCR-CD3 complex, comprising CD3D/CD3E and CD3G/CD3E heterodimers, preferentially associates with TCRalpha and TCRbeta, forming trimers. This hexamer then interacts with CD3Z homodimers to complete the TCR-CD3 complex. Alternatively, TCRalpha and TCRbeta can be replaced by TCRgamma and TCRdelta. The CD3E/CD3 epsilon 1-27 peptide also interacts with CD6, NCK1, and NUMB, with the NUMB interaction being crucial for TCR-CD3 internalization and subsequent degradation.

Cynomolgus

HEK293

C-hFc

Q95LI5 (Q22-D117)

102133065  [NCBI]

QDGNEEMGSITQTPYQVSISGTTVILTCSQHLGSEAQWQHNGKNKEDSGDRLFLPEFSEMEQSGYYVCYPRGSNPEDASHHLYLKARVCENCMEMD

38-55 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCl, 100 mM Glycine, pH 7.5.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.