CD3 gamma Protein, Cynomolgus (P.pastoris, His)

CD3γ protein on lymphocytes is a component of the TCR-CD3 complex and is critical for adaptive immune responses. When the TCR is activated, CD3D, CD3E, CD3G, and CD3Z transmit TCR-mediated signals and activate downstream pathways. CD3 gamma Protein, Cynomolgus (P.pastoris, His) is the recombinant cynomolgus-derived CD3 gamma protein, expressed by P. pastoris , with N-His labeled tag. The total length of CD3 gamma Protein, Cynomolgus (P.pastoris, His) is 91 a.a., with molecular weight of ~12.5 kDa.

CD3 gamma Protein is an integral part of the TCR-CD3 complex found on the surface of T-lymphocytes, playing a crucial role in adaptive immune response. When T-cell receptors (TCRs) on antigen presenting cells (APCs) are activated, CD3D, CD3E, CD3G, and CD3Z transmit TCR-mediated signals across the cell membrane. Each CD3 chain contains immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain, which are phosphorylated by LCK and FYN protein tyrosine kinases upon TCR engagement, leading to downstream signaling activation. Apart from signal transduction, CD3G also plays a vital role in regulating TCR expression at the cell surface, particularly through the di-leucine-based (diL) receptor-sorting motif present in CD3G that influences constitutive TCR cycling. The TCR-CD3 complex consists of CD3D/CD3E and CD3G/CD3E heterodimers that preferentially associate with TCRalpha and TCRbeta, respectively, forming TCRalpha/CD3E/CD3G and TCRbeta/CD3G/CD3E trimers. These trimers then interact with CD3Z homodimer to form the complete TCR-CD3 complex. Alternatively, TCRgamma and TCRdelta can replace TCRalpha and TCRbeta in this complex.

Cynomolgus

P. pastoris

N-His

Q95LI7 (23Q-113T)

102134381  [NCBI]

QSFEENRKLNVYNQEDGSVLLTCHVKNTNITWFKEGKMIDILTAHKNKWNLGSNTKDPRGVYQCKGSKDKSKTLQVYYRMCQNCIELNAAT

Approximately 12.5 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.