CD30 Ligand/TNFSF8 Protein, Human (HEK293, N-His)

CD30 ligand/TNFSF8 protein is a cytokine that specifically binds to TNFRSF8/CD30 and acts as a potent inducer of T cell proliferation. As a homotrimer, this ligand plays a crucial role in regulating T cell activation and growth, contributing to the dynamic coordination of immune responses. CD30 Ligand/TNFSF8 Protein, Human (HEK293, N-His) is the recombinant human-derived CD30 Ligand/TNFSF8 protein, expressed by HEK293 , with N-6*His labeled tag. The total length of CD30 Ligand/TNFSF8 Protein, Human (HEK293, N-His) is 172 a.a., with molecular weight of 21.8 kDa.

CD30 Ligand/TNFSF8 protein, a cytokine, specifically binds to TNFRSF8/CD30, acting as a potent inducer of T-cell proliferation. Operating as a homotrimer, this ligand plays a crucial role in regulating the activation and growth of T-cells, contributing to the dynamic orchestration of immune responses. The interaction between CD30 Ligand and its receptor, TNFRSF8/CD30, highlights its significance as a molecular trigger for the robust expansion of T-cell populations.

Human

HEK293

N-6*His

P32971 (Q63-D234)

944  [NCBI]

QRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD

21.8 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.