2. Recombinant Proteins
  3. Cytokines and Growth Factors CAR-T Related Proteins CD Antigens Biotinylated Proteins
  4. TNF Superfamily T Cell CD Proteins Macrophage CD Proteins Erythrocyte CD Proteins
  5. TNF Receptor Superfamily CD30
  6. CD30/TNFRSF8 Protein, Human (Biotinylated, HEK293, His-Avi)

CD30/TNFRSF8 Protein, Human (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P72354
Handling Instructions

CD30/TNFRSF8 protein (TNFSF8/CD30L receptor) is a key factor regulating cell growth and lymphoblast transformation and may activate NF-kappa-B signaling. CD30/TNFRSF8 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD30/TNFRSF8 protein, expressed by HEK293 , with C-6*His, C-Avi labeled tag. The total length of CD30/TNFRSF8 Protein, Human (Biotinylated, HEK293, His-Avi) is 361 a.a., with molecular weight of 60-90 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD30/TNFRSF8 protein (TNFSF8/CD30L receptor) is a key factor regulating cell growth and lymphoblast transformation and may activate NF-kappa-B signaling. CD30/TNFRSF8 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD30/TNFRSF8 protein, expressed by HEK293 , with C-6*His, C-Avi labeled tag. The total length of CD30/TNFRSF8 Protein, Human (Biotinylated, HEK293, His-Avi) is 361 a.a., with molecular weight of 60-90 kDa.
Background

CD30/TNFRSF8 protein, as a receptor for TNFSF8/CD30L, plays a key role in the regulation of cell growth and transformation of activated lymphoblasts. In addition, it may participate in the regulation of gene expression through the activation of NF-kappa-B signaling, thereby promoting a variety of cellular processes.
Species

Human
Source

HEK293
Tag

C-6*His;C-Avi
Accession

P28908 (F19-K379)
Gene ID

943  [NCBI]
Molecular Construction
N-term
CD30 (F19-K379)
Accession # P28908
6*His-Avi
C-term
Synonyms
CD30L receptor; Ki-1 antigen; Lymphocyte activation antigen CD30; TNFRSF8
AA Sequence

FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGK

Molecular Weight

60-90 kDa
Purity

Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

CD30/TNFRSF8 Protein, Human (Biotinylated, HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD30/TNFRSF8 Protein, Human (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P72354
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.